YIHX - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YIHX - Alpha-D-glucose-1-phosphate phosphatase YihX

UniProt:	P0A8Y3	Sequences: MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKVLC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11850
Length:	199 (183)
Sequences:	27262 (22667)
Seq/√Len:	1675.6

ECOLI - YIHX YNIC GPH YJJG YRFG YFBT YIEH PGMB YIGB YQAB
BACSU - YHCW YFNB PPAX YSAA PGMB
HALSA - Q9HQE2 Q9HP74 Q9HSS2
SULSO - Q7LXL6 Q7LX46 Q97ZU6 Q97WT6 Q97X58 Q97YZ1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
119_E	125_R	3.050	1.00
149_H	153_A	3.040	1.00
139_M	143_E	2.968	1.00
174_A	181_S	2.590	1.00
94_H	127_A	2.561	1.00
111_R	115_T	2.533	1.00
90_I	94_H	2.513	1.00
149_H	152_Q	2.485	1.00
165_D	170_N	2.485	1.00
130_H	153_A	2.305	1.00
102_R	129_D	2.298	1.00
139_M	145_R	2.288	1.00
104_V	130_H	2.280	1.00
106_L	146_I	2.267	1.00
151_L	161_T	2.257	1.00
111_R	136_D	2.198	1.00
151_L	179_I	2.067	1.00
172_E	176_Q	1.960	1.00
157_S	160_D	1.957	1.00
5_F	103_V	1.949	1.00
97_R	127_A	1.942	1.00
107_S	114_T	1.896	1.00
171_I	181_S	1.888	1.00
163_F	174_A	1.787	1.00
95_K	99_Q	1.780	1.00
168_A	172_E	1.750	1.00
4_I	150_V	1.748	1.00
162_V	182_I	1.713	1.00
97_R	129_D	1.672	1.00
4_I	106_L	1.630	1.00
156_F	161_T	1.627	1.00
103_V	128_A	1.620	1.00
3_Y	101_H	1.615	1.00
151_L	158_P	1.594	1.00
144_A	148_Q	1.590	1.00
104_V	154_E	1.558	1.00
4_I	163_F	1.541	1.00
115_T	125_R	1.518	1.00
73_Q	77_G	1.494	1.00
7_L	105_V	1.477	1.00
75_S	79_Q	1.459	1.00
32_A	35_K	1.432	1.00
77_G	81_V	1.412	1.00
10_V	164_F	1.408	1.00
132_Y	153_A	1.387	1.00
3_Y	164_F	1.382	1.00
71_Y	75_S	1.378	1.00
78_W	82_F	1.325	1.00
132_Y	150_V	1.310	1.00
22_A	26_L	1.309	1.00
95_K	98_E	1.307	1.00
4_I	161_T	1.282	1.00
145_R	149_H	1.260	1.00
7_L	12_V	1.257	1.00
115_T	119_E	1.249	1.00
3_Y	96_L	1.227	1.00
74_F	78_W	1.227	1.00
11_I	89_V	1.224	1.00
70_S	73_Q	1.214	1.00
23_W	27_T	1.197	1.00
147_Y	163_F	1.192	1.00
74_F	82_F	1.187	1.00
137_L	149_H	1.181	1.00
175_N	181_S	1.159	1.00
86_R	186_D	1.149	1.00
73_Q	76_H	1.149	1.00
97_R	103_V	1.115	1.00
123_E	126_D	1.113	1.00
148_Q	152_Q	1.108	1.00
173_G	177_L	1.099	1.00
147_Y	173_G	1.097	1.00
44_F	47_H	1.094	1.00
147_Y	179_I	1.092	1.00
105_V	128_A	1.090	1.00
150_V	154_E	1.090	1.00
33_S	36_K	1.083	1.00
116_F	120_E	1.082	1.00
114_T	133_L	1.072	1.00
88_E	91_A	1.064	1.00
54_D	57_F	1.058	1.00
70_S	74_F	1.053	1.00
7_L	109_T	1.051	1.00
22_A	25_D	1.045	1.00
156_F	160_D	1.044	1.00
7_L	114_T	1.034	1.00
130_H	154_E	1.033	1.00
106_L	150_V	1.032	1.00
94_H	98_E	1.023	1.00
107_S	133_L	1.016	1.00
42_E	46_Q	1.015	1.00
148_Q	177_L	1.009	1.00
90_I	127_A	1.007	1.00
161_T	179_I	1.000	1.00
26_L	77_G	0.990	1.00
147_Y	165_D	0.989	1.00
54_D	58_A	0.984	1.00
85_L	124_I	0.981	1.00
145_R	148_Q	0.979	1.00
62_C	65_M	0.976	1.00
4_I	179_I	0.973	1.00
169_D	172_E	0.971	1.00
76_H	80_A	0.967	1.00
32_A	36_K	0.966	1.00
163_F	179_I	0.962	1.00
59_E	63_H	0.957	1.00
111_R	133_L	0.951	1.00
25_D	31_L	0.947	1.00
93_M	128_A	0.947	1.00
21_G	25_D	0.942	1.00
56_A	59_E	0.938	1.00
171_I	183_L	0.935	1.00
91_A	94_H	0.933	1.00
111_R	135_Q	0.921	1.00
62_C	66_A	0.910	1.00
26_L	73_Q	0.910	1.00
85_L	90_I	0.908	1.00
94_H	126_D	0.898	1.00
132_Y	149_H	0.897	1.00
72_E	76_H	0.896	1.00
4_I	154_E	0.895	1.00
148_Q	158_P	0.892	1.00
7_L	117_W	0.883	1.00
46_Q	49_R	0.879	1.00
77_G	80_A	0.871	1.00
104_V	150_V	0.869	1.00
164_F	182_I	0.869	1.00
63_H	66_A	0.866	1.00
56_A	60_A	0.865	1.00
116_F	119_E	0.863	1.00
33_S	37_S	0.863	1.00
76_H	79_Q	0.856	1.00
46_Q	51_E	0.855	1.00
45_H	48_E	0.853	1.00
78_W	81_V	0.851	1.00
86_R	89_V	0.848	1.00
19_V	23_W	0.845	1.00
41_G	45_H	0.841	1.00
133_L	136_D	0.836	1.00
58_A	61_L	0.834	1.00
96_L	101_H	0.830	1.00
57_F	61_L	0.829	1.00
138_G	145_R	0.828	1.00
74_F	77_G	0.825	1.00
86_R	184_V	0.821	1.00
8_G	14_I	0.818	1.00
147_Y	170_N	0.815	1.00
162_V	180_T	0.814	1.00
8_G	107_S	0.814	1.00
43_A	47_H	0.809	1.00
55_E	59_E	0.809	1.00
108_N	140_R	0.807	1.00
158_P	179_I	0.807	1.00
12_V	117_W	0.806	1.00
144_A	176_Q	0.796	1.00
41_G	46_Q	0.795	1.00
42_E	48_E	0.788	1.00
75_S	78_W	0.785	1.00
43_A	46_Q	0.785	1.00
96_L	103_V	0.785	1.00
44_F	48_E	0.784	1.00
90_I	123_E	0.782	1.00
103_V	127_A	0.779	1.00
8_G	109_T	0.779	1.00
114_T	117_W	0.771	1.00
168_A	183_L	0.762	1.00
45_H	49_R	0.761	1.00
56_A	62_C	0.759	1.00
24_S	29_I	0.754	1.00
118_P	125_R	0.747	1.00
91_A	95_K	0.744	1.00
172_E	175_N	0.737	1.00
102_R	156_F	0.737	1.00
20_L	24_S	0.735	1.00
60_A	63_H	0.735	1.00
13_D	86_R	0.725	1.00
61_L	66_A	0.722	1.00
79_Q	82_F	0.721	1.00
136_D	153_A	0.720	1.00
89_V	93_M	0.719	1.00
97_R	100_G	0.716	1.00
90_I	126_D	0.716	1.00
55_E	58_A	0.714	1.00
130_H	150_V	0.713	1.00
61_L	65_M	0.710	1.00
12_V	121_Y	0.708	1.00
42_E	45_H	0.708	1.00
137_L	146_I	0.707	1.00
121_Y	124_I	0.706	1.00
53_S	56_A	0.706	1.00
30_P	33_S	0.705	1.00
16_F	84_A	0.699	1.00
89_V	92_I	0.696	1.00
17_N	83_V	0.692	1.00
103_V	129_D	0.689	1.00
114_T	131_I	0.687	1.00
132_Y	154_E	0.686	1.00
69_L	73_Q	0.686	1.00
46_Q	50_G	0.673	1.00
151_L	156_F	0.672	1.00
151_L	177_L	0.672	1.00
22_A	77_G	0.672	1.00
43_A	48_E	0.672	1.00
146_I	150_V	0.661	1.00
59_E	62_C	0.659	1.00
22_A	81_V	0.657	1.00
93_M	127_A	0.657	1.00
58_A	62_C	0.655	1.00
3_Y	162_V	0.650	1.00
13_D	16_F	0.649	1.00
158_P	161_T	0.649	1.00
48_E	51_E	0.649	1.00
109_T	113_H	0.649	1.00
163_F	173_G	0.645	1.00
60_A	64_E	0.638	1.00
70_S	75_S	0.638	1.00
9_N	15_D	0.633	1.00
114_T	118_P	0.627	1.00
92_I	95_K	0.626	1.00
109_T	114_T	0.626	1.00
13_D	84_A	0.625	1.00
43_A	50_G	0.624	1.00
163_F	170_N	0.622	1.00
75_S	82_F	0.614	1.00
63_H	67_L	0.613	1.00
5_F	92_I	0.613	1.00
108_N	169_D	0.608	1.00
44_F	49_R	0.604	1.00
148_Q	151_L	0.601	1.00
134_S	146_I	0.599	1.00
115_T	131_I	0.593	1.00
92_I	164_F	0.593	1.00
109_T	165_D	0.592	1.00
41_G	44_F	0.586	1.00
180_T	183_L	0.585	1.00
34_L	37_S	0.583	1.00
10_V	170_N	0.581	1.00
4_I	104_V	0.581	1.00
47_H	50_G	0.579	1.00
71_Y	74_F	0.579	1.00
85_L	121_Y	0.575	1.00
171_I	175_N	0.575	1.00
10_V	184_V	0.573	1.00
146_I	173_G	0.570	1.00
12_V	83_V	0.568	1.00
94_H	97_R	0.565	1.00
77_G	82_F	0.558	1.00
106_L	163_F	0.553	1.00
130_H	133_L	0.549	1.00
20_L	23_W	0.549	1.00
112_L	116_F	0.548	1.00
62_C	67_L	0.543	1.00
147_Y	174_A	0.537	1.00
21_G	31_L	0.537	1.00
173_G	176_Q	0.536	1.00
151_L	157_S	0.536	1.00
18_R	109_T	0.534	1.00
74_F	81_V	0.533	1.00
88_E	92_I	0.530	1.00
72_E	75_S	0.529	1.00
71_Y	79_Q	0.528	1.00
8_G	166_D	0.528	1.00
75_S	81_V	0.527	1.00
132_Y	146_I	0.516	1.00
50_G	53_S	0.514	1.00
113_H	117_W	0.510	1.00
97_R	126_D	0.510	1.00
14_I	109_T	0.510	1.00
57_F	62_C	0.509	1.00
128_A	131_I	0.508	1.00
71_Y	81_V	0.508	1.00
144_A	177_L	0.506	1.00
175_N	180_T	0.505	1.00
170_N	173_G	0.504	1.00
145_R	152_Q	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2b0cA	2	0.9899	100	0.262	Contact Map
4jb3A	1	0.9849	100	0.271	Contact Map
2i6xA	1	0.9698	100	0.282	Contact Map
4dccA	1	0.9698	100	0.313	Contact Map
5am2A	2	0.995	100	0.315	Contact Map
3cnhA	1	0.9749	100	0.351	Contact Map
2zg6A	2	0.9045	100	0.362	Contact Map
3iruA	4	0.9899	100	0.362	Contact Map
3ed5A	1	0.9899	100	0.364	Contact Map
1swvA	2	0.9899	100	0.365	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.