FLIE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLIE - Flagellar hook-basal body complex protein FliE

UniProt:	P0A8T5	Sequences: MSAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDRISDTQTAARTQAEKFTLGEPGVALNDVMTDMQKASVSMQMGIQVRNKLVAAYQEVMSMQV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11346
Length:	104 (93)
Sequences:	1058 (799)
Seq/√Len:	82.8

ECOLI - FLIE
BACSU - FLIE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_T	81_S	3.729	1.00
58_K	63_E	3.722	1.00
39_H	43_D	3.081	1.00
45_I	85_G	3.043	1.00
59_F	71_V	2.997	1.00
67_A	70_D	2.985	1.00
42_L	85_G	2.845	1.00
46_S	50_T	2.622	1.00
94_A	97_Q	2.539	1.00
81_S	85_G	2.483	1.00
44_R	47_D	2.299	1.00
97_Q	101_S	2.229	1.00
83_Q	87_Q	2.228	1.00
57_E	61_L	1.942	1.00
14_L	17_T	1.783	1.00
56_A	75_M	1.716	1.00
98_E	101_S	1.521	0.99
55_Q	74_D	1.505	0.99
54_T	57_E	1.395	0.99
51_A	55_Q	1.385	0.99
54_T	58_K	1.348	0.99
44_R	48_T	1.296	0.98
50_T	54_T	1.283	0.98
70_D	77_K	1.280	0.98
17_T	21_A	1.257	0.98
46_S	49_Q	1.232	0.98
60_T	103_Q	1.216	0.97
33_S	36_G	1.210	0.97
14_L	18_A	1.191	0.97
52_A	56_A	1.164	0.97
83_Q	86_I	1.135	0.96
27_L	31_T	1.130	0.96
51_A	54_T	1.086	0.95
36_G	39_H	1.082	0.95
40_A	94_A	1.048	0.94
47_D	51_A	1.046	0.94
52_A	78_A	1.035	0.94
55_Q	66_V	1.001	0.92
77_K	100_M	0.984	0.92
27_L	30_P	0.980	0.92
69_N	86_I	0.975	0.91
36_G	40_A	0.972	0.91
55_Q	58_K	0.956	0.91
94_A	103_Q	0.949	0.90
37_Q	85_G	0.949	0.90
78_A	81_S	0.936	0.90
51_A	74_D	0.935	0.90
71_V	97_Q	0.920	0.89
53_R	78_A	0.905	0.88
66_V	70_D	0.892	0.87
68_L	79_S	0.891	0.87
82_M	87_Q	0.865	0.86
91_K	94_A	0.862	0.86
12_S	22_R	0.858	0.85
30_P	51_A	0.851	0.85
42_L	87_Q	0.850	0.85
94_A	98_E	0.842	0.84
82_M	85_G	0.836	0.84
54_T	63_E	0.827	0.83
95_A	99_V	0.824	0.83
38_L	41_A	0.820	0.83
34_F	38_L	0.807	0.82
40_A	43_D	0.800	0.81
46_S	71_V	0.784	0.80
45_I	82_M	0.770	0.78
49_Q	82_M	0.765	0.78
74_D	78_A	0.762	0.78
52_A	84_M	0.759	0.77
87_Q	94_A	0.758	0.77
22_R	54_T	0.757	0.77
33_S	45_I	0.756	0.77
19_M	86_I	0.754	0.77
14_L	21_A	0.750	0.77
26_S	29_Q	0.750	0.77
37_Q	84_M	0.746	0.76
53_R	80_V	0.737	0.75
45_I	48_T	0.720	0.74
13_Q	39_H	0.705	0.72
35_A	39_H	0.703	0.72
65_G	71_V	0.701	0.72
71_V	75_M	0.695	0.71
16_A	20_S	0.695	0.71
17_T	104_V	0.686	0.70
64_P	87_Q	0.678	0.69
22_R	25_E	0.677	0.69
17_T	20_S	0.668	0.68
56_A	80_V	0.663	0.67
70_D	91_K	0.661	0.67
52_A	81_S	0.660	0.67
13_Q	70_D	0.659	0.67
52_A	71_V	0.656	0.67
35_A	76_Q	0.651	0.66
25_E	28_P	0.650	0.66
20_S	25_E	0.650	0.66
19_M	22_R	0.644	0.65
60_T	69_N	0.643	0.65
39_H	95_A	0.642	0.65
37_Q	41_A	0.641	0.65
35_A	71_V	0.630	0.63
40_A	73_T	0.620	0.62
20_S	99_V	0.619	0.62
89_R	97_Q	0.619	0.62
13_Q	16_A	0.613	0.61
69_N	84_M	0.613	0.61
81_S	87_Q	0.611	0.61
76_Q	95_A	0.610	0.61
69_N	74_D	0.606	0.60
82_M	86_I	0.605	0.60
74_D	84_M	0.600	0.60
90_N	97_Q	0.598	0.59
52_A	75_M	0.597	0.59
17_T	22_R	0.596	0.59
100_M	104_V	0.594	0.59
79_S	100_M	0.591	0.59
85_G	92_L	0.588	0.58
14_L	70_D	0.585	0.58
56_A	71_V	0.584	0.58
76_Q	88_V	0.583	0.58
83_Q	99_V	0.582	0.57
67_A	71_V	0.576	0.57
59_F	68_L	0.576	0.57
49_Q	80_V	0.565	0.55
53_R	57_E	0.563	0.55
44_R	53_R	0.555	0.54
18_A	21_A	0.550	0.53
52_A	74_D	0.547	0.53
29_Q	57_E	0.546	0.53
69_N	73_T	0.542	0.52
68_L	80_V	0.540	0.52
12_S	15_Q	0.540	0.52
97_Q	103_Q	0.539	0.52
15_Q	82_M	0.538	0.52
69_N	75_M	0.538	0.52
55_Q	70_D	0.538	0.52
41_A	86_I	0.535	0.51
39_H	49_Q	0.528	0.50
21_A	24_Q	0.528	0.50
19_M	31_T	0.522	0.50
79_S	93_V	0.520	0.49
38_L	96_Y	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ut1A	1	0.5769	13	0.922	Contact Map
2ca5A	1	0.6154	8.1	0.928	Contact Map
3a69A	3	0.8558	6.4	0.932	Contact Map
3v47C	1	0.9808	6.2	0.932	Contact Map
1io1A	1	0.8269	5	0.935	Contact Map
3zqeA	1	0.6731	4.2	0.937	Contact Map
4cfiA	1	0.9135	4.2	0.937	Contact Map
4um2A	1	0.5192	3.8	0.939	Contact Map
1zzpA	1	0.4712	3.7	0.939	Contact Map
1y4cA	1	0.4423	3.5	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.