FLHD - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLHD - Flagellar transcriptional regulator FlhD

UniProt:	P0A8S9	Sequences: MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLAALTLPQMVKLAETNQLVCHFRFDSHQTITQLTQDSRVDDLQQIHTGIMLSTRLLNDVNQPEEALRKKRA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10320
Length:	116 (101)
Sequences:	213 (118)
Seq/√Len:	11.8

ECOLI - FLHD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_G	68_R	4.209	1.00
66_H	70_D	3.210	0.97
22_Q	26_V	2.492	0.88
22_Q	34_F	2.463	0.88
25_I	32_A	2.444	0.87
29_K	44_T	2.207	0.81
33_M	43_A	2.188	0.80
19_L	59_E	2.038	0.75
24_L	57_L	2.007	0.74
75_I	99_R	1.950	0.72
90_I	93_G	1.925	0.71
46_L	76_T	1.920	0.71
31_S	90_I	1.910	0.70
23_R	62_Q	1.823	0.67
9_H	16_S	1.694	0.61
34_F	91_H	1.542	0.53
20_L	35_R	1.515	0.52
37_G	94_I	1.501	0.51
32_A	70_D	1.486	0.50
33_M	69_F	1.485	0.50
52_P	94_I	1.477	0.50
9_H	66_H	1.444	0.48
77_Q	81_D	1.438	0.48
61_N	86_D	1.432	0.48
71_S	78_L	1.428	0.48
69_F	77_Q	1.397	0.46
59_E	89_Q	1.369	0.45
43_A	98_T	1.362	0.44
9_H	38_I	1.360	0.44
28_D	98_T	1.344	0.43
42_M	74_T	1.343	0.43
53_Q	95_M	1.314	0.42
31_S	84_V	1.301	0.41
49_L	79_T	1.284	0.40
57_L	96_L	1.254	0.39
19_L	27_Q	1.248	0.39
37_G	74_T	1.239	0.38
64_V	95_M	1.225	0.38
44_T	95_M	1.191	0.36
37_G	55_V	1.189	0.36
50_T	70_D	1.185	0.36
7_L	61_N	1.175	0.35
4_S	19_L	1.172	0.35
16_S	78_L	1.162	0.35
7_L	58_A	1.160	0.35
49_L	54_M	1.149	0.34
59_E	74_T	1.137	0.34
25_I	63_L	1.130	0.33
11_Y	52_P	1.110	0.32
26_V	66_H	1.107	0.32
38_I	46_L	1.107	0.32
8_K	11_Y	1.091	0.32
15_L	70_D	1.072	0.31
66_H	102_N	1.055	0.30
25_I	47_A	1.053	0.30
53_Q	65_C	1.051	0.30
95_M	102_N	1.026	0.29
18_L	101_L	1.002	0.28
78_L	93_G	0.977	0.27
92_T	96_L	0.970	0.27
8_K	69_F	0.927	0.25
43_A	69_F	0.919	0.25
11_Y	59_E	0.911	0.24
19_L	52_P	0.899	0.24
25_I	78_L	0.895	0.24
3_T	46_L	0.888	0.24
16_S	63_L	0.882	0.23
57_L	73_Q	0.881	0.23
23_R	77_Q	0.874	0.23
33_M	48_A	0.871	0.23
86_D	96_L	0.842	0.22
7_L	65_C	0.842	0.22
53_Q	80_Q	0.838	0.22
26_V	60_T	0.831	0.22
68_R	94_I	0.830	0.22
51_L	56_K	0.823	0.21
55_V	80_Q	0.812	0.21
22_Q	92_T	0.809	0.21
61_N	64_V	0.802	0.21
55_V	81_D	0.797	0.21
55_V	68_R	0.788	0.20
4_S	73_Q	0.779	0.20
88_Q	94_I	0.768	0.20
51_L	74_T	0.762	0.19
15_L	32_A	0.759	0.19
32_A	40_E	0.756	0.19
38_I	41_E	0.746	0.19
39_N	103_D	0.732	0.18
35_R	91_H	0.722	0.18
84_V	90_I	0.719	0.18
29_K	82_S	0.716	0.18
3_T	87_L	0.707	0.18
28_D	63_L	0.702	0.18
29_K	43_A	0.690	0.17
42_M	72_H	0.688	0.17
23_R	27_Q	0.687	0.17
57_L	75_I	0.683	0.17
61_N	65_C	0.683	0.17
56_K	95_M	0.678	0.17
40_E	62_Q	0.678	0.17
46_L	71_S	0.670	0.17
50_T	87_L	0.667	0.17
19_L	96_L	0.659	0.16
62_Q	90_I	0.658	0.16
92_T	101_L	0.645	0.16
33_M	51_L	0.641	0.16
66_H	74_T	0.640	0.16
21_A	56_K	0.639	0.16
21_A	68_R	0.639	0.16
63_L	97_S	0.633	0.16
38_I	59_E	0.623	0.15
13_I	58_A	0.618	0.15
64_V	75_I	0.615	0.15
32_A	36_L	0.606	0.15
37_G	59_E	0.606	0.15
55_V	88_Q	0.603	0.15
82_S	98_T	0.602	0.15
55_V	94_I	0.602	0.15
21_A	37_G	0.600	0.15
28_D	31_S	0.598	0.15
32_A	94_I	0.597	0.15
41_E	60_T	0.586	0.14
38_I	84_V	0.582	0.14
45_T	67_F	0.582	0.14
23_R	75_I	0.570	0.14
52_P	67_F	0.570	0.14
48_A	54_M	0.558	0.14
37_G	50_T	0.558	0.14
43_A	95_M	0.557	0.14
28_D	44_T	0.556	0.14
19_L	89_Q	0.556	0.14
13_I	85_D	0.555	0.14
42_M	100_L	0.551	0.14
94_I	99_R	0.551	0.14
3_T	98_T	0.546	0.14
7_L	16_S	0.542	0.13
4_S	103_D	0.533	0.13
70_D	94_I	0.532	0.13
52_P	102_N	0.530	0.13
61_N	89_Q	0.529	0.13
8_K	50_T	0.526	0.13
51_L	62_Q	0.525	0.13
6_L	30_A	0.524	0.13
28_D	85_D	0.518	0.13
64_V	100_L	0.516	0.13
7_L	25_I	0.511	0.13
61_N	96_L	0.510	0.13
83_R	90_I	0.506	0.13
8_K	101_L	0.505	0.13
44_T	56_K	0.503	0.13
9_H	74_T	0.500	0.12
40_E	99_R	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1g8eA	2	0.8448	100	0.089	Contact Map
1so9A	1	0.2241	8.9	0.944	Contact Map
4eivA	2	0.4741	3.8	0.953	Contact Map
1i7fA	2	0.319	3.5	0.954	Contact Map
4ag6A	2	0.6552	3.4	0.954	Contact Map
1vkeA	6	0.8879	3	0.956	Contact Map
1vzyA	3	0.6724	2.4	0.958	Contact Map
2llwA	1	0.4741	2.3	0.958	Contact Map
4lunU	1	0.6983	2.1	0.959	Contact Map
2qq8A	1	0.2672	2	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.