FETP - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FETP - Probable Fe(2+)-trafficking protein

UniProt:	P0A8P3	Sequences: MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQTMLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTPEDKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12984
Length:	91 (88)
Sequences:	611 (285)
Seq/√Len:	30.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_D	36_K	4.240	1.00
6_F	11_Q	4.134	1.00
15_E	36_K	3.257	1.00
28_K	32_N	3.155	1.00
12_R	37_E	2.936	1.00
3_R	16_G	2.924	1.00
69_E	72_N	2.539	0.99
65_L	80_V	2.430	0.99
16_G	31_Y	2.299	0.99
85_Y	88_E	1.923	0.96
10_L	14_A	1.895	0.96
26_L	29_R	1.689	0.93
3_R	31_Y	1.651	0.92
22_Y	70_M	1.574	0.90
10_L	37_E	1.526	0.88
65_L	69_E	1.510	0.88
29_R	75_F	1.469	0.86
22_Y	67_E	1.456	0.86
59_N	62_H	1.434	0.85
48_M	82_I	1.396	0.83
8_T	34_I	1.375	0.82
53_K	65_L	1.322	0.80
8_T	33_E	1.294	0.78
22_Y	30_I	1.257	0.76
5_I	34_I	1.223	0.74
20_Q	31_Y	1.216	0.74
41_Q	73_F	1.213	0.73
64_K	68_Q	1.213	0.73
48_M	84_G	1.206	0.73
29_R	33_E	1.206	0.73
48_M	58_M	1.199	0.73
14_A	37_E	1.196	0.72
9_F	21_L	1.188	0.72
10_L	35_S	1.169	0.71
52_E	85_Y	1.147	0.69
76_E	79_E	1.050	0.62
34_I	81_H	1.048	0.62
25_E	28_K	1.044	0.62
23_P	47_T	1.031	0.61
61_E	68_Q	1.028	0.61
29_R	71_V	1.015	0.60
74_L	77_G	1.004	0.59
53_K	84_G	1.002	0.59
45_K	81_H	0.989	0.58
2_S	18_D	0.984	0.57
45_K	79_E	0.973	0.56
37_E	41_Q	0.932	0.53
57_M	67_E	0.923	0.52
9_F	41_Q	0.917	0.52
48_M	85_Y	0.914	0.52
34_I	74_L	0.908	0.51
6_F	13_E	0.900	0.50
81_H	84_G	0.896	0.50
47_T	63_R	0.887	0.49
63_R	70_M	0.886	0.49
26_L	75_F	0.868	0.48
45_K	49_L	0.843	0.46
4_T	13_E	0.843	0.46
22_Y	57_M	0.835	0.45
53_K	83_E	0.829	0.45
23_P	63_R	0.816	0.44
3_R	32_N	0.793	0.42
18_D	40_A	0.774	0.41
57_M	70_M	0.761	0.40
46_Q	52_E	0.758	0.39
4_T	15_E	0.742	0.38
49_L	65_L	0.734	0.37
69_E	81_H	0.733	0.37
53_K	69_E	0.732	0.37
24_G	56_N	0.725	0.37
61_E	65_L	0.712	0.36
43_Q	57_M	0.712	0.36
21_L	45_K	0.697	0.35
26_L	71_V	0.688	0.34
61_E	64_K	0.682	0.34
23_P	59_N	0.680	0.34
54_K	59_N	0.678	0.33
35_S	62_H	0.677	0.33
19_F	22_Y	0.675	0.33
53_K	79_E	0.675	0.33
17_Q	21_L	0.674	0.33
57_M	63_R	0.673	0.33
57_M	65_L	0.669	0.33
65_L	82_I	0.668	0.33
67_E	70_M	0.663	0.32
45_K	48_M	0.655	0.32
4_T	14_A	0.651	0.31
50_I	58_M	0.650	0.31
64_K	86_T	0.648	0.31
78_K	83_E	0.645	0.31
56_N	60_A	0.645	0.31
46_Q	63_R	0.638	0.31
11_Q	40_A	0.629	0.30
49_L	70_M	0.628	0.30
26_L	53_K	0.627	0.30
17_Q	33_E	0.626	0.30
10_L	75_F	0.621	0.29
34_I	76_E	0.609	0.29
25_E	76_E	0.608	0.29
50_I	73_F	0.604	0.28
49_L	63_R	0.594	0.28
45_K	78_K	0.585	0.27
58_M	70_M	0.580	0.27
19_F	58_M	0.579	0.27
3_R	24_G	0.576	0.27
19_F	25_E	0.574	0.26
8_T	74_L	0.572	0.26
62_H	82_I	0.570	0.26
60_A	83_E	0.566	0.26
49_L	54_K	0.563	0.26
25_E	68_Q	0.562	0.26
49_L	74_L	0.561	0.26
6_F	37_E	0.560	0.26
23_P	46_Q	0.560	0.26
4_T	50_I	0.545	0.25
11_Q	41_Q	0.545	0.25
5_I	17_Q	0.535	0.24
49_L	52_E	0.534	0.24
72_N	77_G	0.529	0.24
45_K	72_N	0.528	0.24
20_Q	72_N	0.520	0.23
2_S	30_I	0.518	0.23
43_Q	68_Q	0.514	0.23
46_Q	49_L	0.512	0.23
8_T	75_F	0.511	0.23
43_Q	67_E	0.510	0.23
56_N	59_N	0.504	0.22
29_R	76_E	0.504	0.22
26_L	30_I	0.504	0.22
9_F	62_H	0.501	0.22
40_A	43_Q	0.501	0.22
43_Q	54_K	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xs8A	1	1	100	0.02	Contact Map
1t07A	1	0.8681	100	0.029	Contact Map
2mzyA	1	1	100	0.029	Contact Map
2m5wA	1	0.3736	13.5	0.94	Contact Map
3ljbA	2	0.7582	13.2	0.94	Contact Map
2owlA	2	0.5275	9.9	0.943	Contact Map
2qm4A	2	0.3846	8.5	0.945	Contact Map
2vooA	1	0.3736	6.8	0.947	Contact Map
2owyA	2	0.5165	6.7	0.947	Contact Map
4pzuA	4	0.3626	6.1	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.