YIHI - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YIHI - Der GTPase-activating protein YihI

UniProt:	P0A8H6	Sequences: MKPSSSNSRSKGHAKARRKTREELDQEARDRKRQKKRRGHAPGSRAAGGNTTSGSKGQNAPKDPRIGSKTPIPLGVTEKVTKQHKPKSEKPMLSPQAELELLETDERLDALLERLEAGETLSAEEQSWVDAKLDRIDELMQKLGLSYDDDEEEEEDEKQEDMMRLLRGN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11835
Length:	169 (150)
Sequences:	280 (208)
Seq/√Len:	17.0

ECOLI - YIHI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
114_R	119_E	4.593	1.00
136_I	140_M	3.665	1.00
62_K	66_I	3.325	0.99
98_E	135_R	2.865	0.98
141_Q	145_L	2.812	0.98
102_L	136_I	2.765	0.98
85_K	89_E	2.576	0.96
42_P	46_A	2.404	0.94
27_E	31_R	2.362	0.94
122_S	125_E	2.309	0.93
47_A	124_E	2.289	0.93
42_P	93_L	2.259	0.92
126_Q	133_L	2.149	0.90
10_S	13_H	2.034	0.88
133_L	136_I	2.021	0.87
11_K	14_A	2.018	0.87
105_D	128_W	2.004	0.87
25_D	37_R	1.809	0.80
123_A	126_Q	1.762	0.79
103_E	112_L	1.752	0.78
8_S	13_H	1.670	0.75
7_N	10_S	1.639	0.73
18_R	22_E	1.622	0.72
134_D	140_M	1.599	0.71
80_V	85_K	1.596	0.71
100_E	116_E	1.575	0.70
62_K	131_A	1.552	0.69
76_V	129_V	1.550	0.69
141_Q	147_Y	1.537	0.68
9_R	12_G	1.536	0.68
115_L	145_L	1.519	0.67
107_R	128_W	1.472	0.65
8_S	16_A	1.459	0.64
25_D	71_P	1.432	0.63
102_L	133_L	1.403	0.61
51_T	81_T	1.369	0.59
125_E	128_W	1.340	0.57
20_T	23_E	1.332	0.57
90_K	95_P	1.323	0.56
7_N	12_G	1.316	0.56
59_N	81_T	1.298	0.55
97_A	100_E	1.259	0.53
50_N	89_E	1.259	0.53
95_P	137_D	1.252	0.52
25_D	136_I	1.250	0.52
50_N	150_D	1.239	0.51
122_S	128_W	1.231	0.51
62_K	106_E	1.230	0.51
15_K	137_D	1.215	0.50
18_R	30_D	1.204	0.49
114_R	142_K	1.198	0.49
44_S	49_G	1.193	0.49
69_K	72_I	1.193	0.49
19_K	105_D	1.173	0.47
115_L	129_V	1.144	0.46
57_G	60_A	1.136	0.45
95_P	135_R	1.133	0.45
118_G	133_L	1.132	0.45
126_Q	129_V	1.130	0.45
130_D	133_L	1.120	0.44
117_A	152_E	1.088	0.42
107_R	125_E	1.070	0.41
94_S	116_E	1.064	0.41
38_R	137_D	1.061	0.41
21_R	25_D	1.049	0.40
57_G	71_P	1.046	0.40
95_P	98_E	1.046	0.40
22_E	25_D	1.040	0.40
75_G	86_P	1.035	0.39
59_N	86_P	1.026	0.39
7_N	29_R	1.024	0.39
15_K	20_T	1.020	0.38
25_D	28_A	1.009	0.38
36_K	98_E	1.008	0.38
56_K	141_Q	1.004	0.38
57_G	62_K	1.000	0.37
109_D	140_M	0.998	0.37
25_D	116_E	0.975	0.36
27_E	140_M	0.966	0.35
97_A	147_Y	0.965	0.35
82_K	150_D	0.964	0.35
50_N	56_K	0.960	0.35
35_K	69_K	0.950	0.35
105_D	114_R	0.943	0.34
55_S	148_D	0.940	0.34
79_K	102_L	0.937	0.34
107_R	132_K	0.936	0.34
49_G	89_E	0.934	0.34
28_A	31_R	0.927	0.33
25_D	137_D	0.924	0.33
12_G	118_G	0.920	0.33
116_E	129_V	0.913	0.33
15_K	136_I	0.907	0.32
95_P	120_T	0.904	0.32
10_S	145_L	0.901	0.32
40_H	107_R	0.894	0.32
21_R	24_L	0.887	0.31
113_E	126_Q	0.874	0.31
57_G	148_D	0.871	0.30
20_T	24_L	0.863	0.30
41_A	120_T	0.862	0.30
17_R	60_A	0.860	0.30
53_S	58_Q	0.849	0.29
15_K	116_E	0.846	0.29
127_S	150_D	0.845	0.29
55_S	84_H	0.845	0.29
21_R	32_K	0.842	0.29
55_S	86_P	0.828	0.28
102_L	116_E	0.808	0.27
37_R	40_H	0.807	0.27
8_S	50_N	0.800	0.27
77_T	132_K	0.798	0.27
50_N	58_Q	0.797	0.27
10_S	16_A	0.796	0.27
44_S	62_K	0.793	0.27
27_E	109_D	0.792	0.27
20_T	37_R	0.792	0.27
9_R	13_H	0.787	0.26
64_P	130_D	0.785	0.26
76_V	138_E	0.782	0.26
72_I	132_K	0.780	0.26
72_I	122_S	0.777	0.26
8_S	11_K	0.777	0.26
10_S	94_S	0.771	0.26
104_T	157_E	0.770	0.26
38_R	147_Y	0.762	0.25
23_E	32_K	0.755	0.25
63_D	139_L	0.744	0.24
28_A	57_G	0.742	0.24
126_Q	130_D	0.740	0.24
19_K	71_P	0.739	0.24
36_K	135_R	0.737	0.24
32_K	36_K	0.734	0.24
100_E	132_K	0.730	0.24
56_K	86_P	0.728	0.24
24_L	28_A	0.727	0.24
9_R	149_D	0.723	0.23
53_S	146_S	0.722	0.23
76_V	153_E	0.717	0.23
47_A	158_K	0.714	0.23
112_L	136_I	0.713	0.23
60_A	152_E	0.712	0.23
32_K	104_T	0.711	0.23
9_R	16_A	0.711	0.23
98_E	104_T	0.711	0.23
72_I	100_E	0.708	0.23
49_G	87_K	0.707	0.23
29_R	140_M	0.706	0.23
13_H	145_L	0.703	0.23
35_K	124_E	0.701	0.23
95_P	153_E	0.699	0.22
58_Q	150_D	0.698	0.22
52_T	55_S	0.695	0.22
7_N	49_G	0.695	0.22
75_G	149_D	0.689	0.22
8_S	92_M	0.689	0.22
41_A	105_D	0.687	0.22
52_T	153_E	0.685	0.22
15_K	90_K	0.684	0.22
53_S	87_K	0.682	0.22
53_S	75_G	0.677	0.22
21_R	85_K	0.675	0.21
35_K	102_L	0.672	0.21
92_M	140_M	0.666	0.21
49_G	82_K	0.664	0.21
96_Q	146_S	0.662	0.21
12_G	16_A	0.655	0.21
25_D	148_D	0.648	0.20
66_I	106_E	0.645	0.20
53_S	93_L	0.644	0.20
73_P	76_V	0.636	0.20
101_L	129_V	0.636	0.20
27_E	105_D	0.632	0.20
52_T	57_G	0.630	0.20
83_Q	86_P	0.628	0.20
15_K	18_R	0.626	0.20
24_L	34_Q	0.622	0.19
79_K	150_D	0.620	0.19
107_R	115_L	0.619	0.19
51_T	154_E	0.616	0.19
115_L	126_Q	0.615	0.19
119_E	135_R	0.605	0.19
19_K	128_W	0.600	0.19
93_L	140_M	0.594	0.18
28_A	100_E	0.592	0.18
107_R	124_E	0.590	0.18
21_R	102_L	0.582	0.18
19_K	31_R	0.581	0.18
10_S	142_K	0.575	0.18
59_N	153_E	0.568	0.17
18_R	128_W	0.563	0.17
85_K	91_P	0.563	0.17
32_K	109_D	0.562	0.17
17_R	20_T	0.561	0.17
97_A	132_K	0.559	0.17
72_I	76_V	0.559	0.17
49_G	55_S	0.549	0.17
90_K	109_D	0.547	0.17
104_T	135_R	0.546	0.17
80_V	94_S	0.545	0.17
87_K	95_P	0.545	0.17
33_R	37_R	0.542	0.17
7_N	42_P	0.540	0.17
64_P	118_G	0.539	0.17
41_A	128_W	0.535	0.16
52_T	59_N	0.534	0.16
115_L	128_W	0.534	0.16
42_P	61_P	0.534	0.16
23_E	140_M	0.531	0.16
116_E	133_L	0.529	0.16
11_K	16_A	0.528	0.16
95_P	107_R	0.527	0.16
8_S	12_G	0.523	0.16
104_T	125_E	0.518	0.16
105_D	132_K	0.517	0.16
55_S	58_Q	0.516	0.16
117_A	128_W	0.511	0.16
9_R	14_A	0.508	0.16
95_P	142_K	0.508	0.16
140_M	145_L	0.507	0.15
103_E	136_I	0.506	0.15
48_G	52_T	0.504	0.15
91_P	121_L	0.501	0.15
92_M	114_R	0.500	0.15
38_R	159_Q	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2outA	1	0.5621	47	0.939	Contact Map
1vp7A	2	0.4142	41	0.941	Contact Map
8tfvA	1	0.1243	19.5	0.95	Contact Map
4itqA	1	0.3964	15.9	0.952	Contact Map
4x8kA	1	0.432	11.1	0.955	Contact Map
1l9zH	1	0.426	7.1	0.959	Contact Map
2k0mA	1	0.503	6.2	0.96	Contact Map
3zrgA	2	0.2899	5.6	0.961	Contact Map
3nwzA	3	0.3432	5.5	0.961	Contact Map
2wmmA	2	0.497	5.2	0.961	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.