UBIE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

UBIE - Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE

UniProt:	P0A887	Sequences: MVDKSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLSKAYDAYSFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALHRGYKF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11473
Length:	251 (209)
Sequences:	8249 (6072)
Seq/√Len:	420.0

ECOLI - UBIE CMOA UBIG SMTA BIOC YJHP TAM TEHB CMOB YAFE
BACSU - MENG YBAJ YXBB YRRT YCGJ YRHH YODH YQEM YDAC
HALSA - Q9HR81 Q9HMT2 Q9HND6 ARSM Q9HRX3 Q9HR63 Q9HQ85 Q9HSK6
SULSO - Q97XD7 Q7LXN7 Q97ZU8 Q97X57 Q97WN4 Q97WT7 Q97YX4 Q97WH3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_T	90_K	3.342	1.00
98_E	121_Q	3.027	1.00
94_A	122_A	2.882	1.00
71_A	142_G	2.878	1.00
150_D	227_D	2.809	1.00
156_M	166_L	2.699	1.00
72_G	93_L	2.648	1.00
83_R	111_I	2.621	1.00
92_V	134_F	2.599	1.00
135_D	161_K	2.595	1.00
103_M	106_E	2.588	1.00
68_L	134_F	2.565	1.00
98_E	102_K	2.451	1.00
157_Y	230_F	2.400	1.00
217_D	220_T	2.389	1.00
129_F	134_F	2.330	1.00
155_S	158_R	2.301	1.00
90_K	118_E	2.200	1.00
137_I	156_M	2.188	1.00
70_L	156_M	2.167	1.00
150_D	154_R	2.134	1.00
67_V	81_F	2.107	1.00
72_G	78_T	2.100	1.00
101_L	121_Q	2.057	1.00
150_D	224_M	2.043	1.00
30_H	99_S	2.040	1.00
222_K	226_Q	1.978	1.00
78_T	91_V	1.957	1.00
79_A	108_L	1.946	1.00
108_L	119_Y	1.925	1.00
160_L	166_L	1.870	1.00
149_K	224_M	1.862	1.00
104_G	119_Y	1.859	1.00
30_H	97_N	1.820	1.00
146_V	152_A	1.797	1.00
101_L	119_Y	1.772	1.00
92_V	120_V	1.699	1.00
65_Q	136_C	1.682	1.00
148_D	151_K	1.667	1.00
122_A	128_P	1.643	1.00
71_A	139_I	1.638	1.00
37_D	74_T	1.637	1.00
137_I	160_L	1.622	1.00
66_T	92_V	1.615	1.00
93_L	119_Y	1.576	1.00
79_A	107_K	1.506	1.00
223_A	226_Q	1.482	1.00
102_K	105_R	1.480	1.00
223_A	227_D	1.475	1.00
62_R	65_Q	1.465	1.00
96_I	123_N	1.444	1.00
151_K	154_R	1.436	1.00
160_L	164_G	1.409	1.00
160_L	230_F	1.402	1.00
67_V	136_C	1.390	1.00
66_T	161_K	1.386	1.00
66_T	134_F	1.383	1.00
155_S	159_V	1.382	1.00
92_V	118_E	1.364	1.00
123_N	126_A	1.360	1.00
80_K	83_R	1.341	1.00
124_A	142_G	1.340	1.00
54_F	236_Y	1.331	1.00
128_P	155_S	1.312	1.00
78_T	93_L	1.300	1.00
35_K	38_V	1.292	1.00
75_G	104_G	1.286	1.00
79_A	111_I	1.242	1.00
68_L	137_I	1.229	1.00
94_A	127_L	1.228	1.00
66_T	135_D	1.228	1.00
58_C	236_Y	1.209	1.00
105_R	109_R	1.203	1.00
137_I	159_V	1.197	1.00
70_L	124_A	1.196	1.00
55_T	167_L	1.175	1.00
54_F	58_C	1.173	1.00
131_D	158_R	1.162	1.00
66_T	133_T	1.158	1.00
82_S	116_N	1.150	1.00
75_G	119_Y	1.149	1.00
130_P	133_T	1.147	1.00
76_D	107_K	1.143	1.00
150_D	228_A	1.130	1.00
94_A	120_V	1.125	1.00
67_V	91_V	1.125	1.00
125_E	148_D	1.108	1.00
222_K	235_Y	1.099	1.00
156_M	160_L	1.076	1.00
101_L	105_R	1.070	1.00
202_A	206_R	1.066	1.00
48_H	51_W	1.056	1.00
127_L	159_V	1.050	1.00
95_D	101_L	1.049	1.00
127_L	155_S	1.048	1.00
99_S	102_K	1.045	1.00
26_A	30_H	1.040	1.00
53_R	57_D	1.038	1.00
78_T	117_V	1.036	1.00
80_K	84_L	1.028	1.00
141_F	145_N	1.026	1.00
72_G	104_G	1.021	1.00
139_I	142_G	1.018	1.00
152_A	156_M	1.015	1.00
61_V	65_Q	1.011	1.00
37_D	107_K	1.008	1.00
69_D	93_L	1.008	1.00
190_V	194_I	0.995	1.00
79_A	83_R	0.986	1.00
185_A	189_H	0.983	1.00
65_Q	89_G	0.976	1.00
220_T	223_A	0.965	1.00
106_E	110_N	0.964	1.00
200_N	204_S	0.953	1.00
53_R	80_K	0.939	1.00
218_Q	222_K	0.939	1.00
120_V	129_F	0.925	1.00
77_L	140_S	0.921	1.00
70_L	137_I	0.921	1.00
70_L	94_A	0.918	1.00
93_L	104_G	0.917	1.00
157_Y	160_L	0.916	1.00
106_E	109_R	0.914	1.00
92_V	129_F	0.911	1.00
76_D	80_K	0.904	1.00
55_T	77_L	0.893	1.00
143_L	146_V	0.892	1.00
64_G	89_G	0.891	1.00
187_S	191_L	0.889	1.00
59_S	136_C	0.887	1.00
53_R	84_L	0.886	1.00
193_R	196_S	0.883	1.00
81_F	138_T	0.879	1.00
143_L	221_L	0.876	1.00
78_T	119_Y	0.874	1.00
101_L	104_G	0.873	1.00
196_S	202_A	0.872	1.00
141_F	144_R	0.869	1.00
82_S	113_V	0.868	1.00
83_R	113_V	0.867	1.00
74_T	100_M	0.865	1.00
129_F	159_V	0.864	1.00
97_N	100_M	0.863	1.00
126_A	151_K	0.859	1.00
57_D	84_L	0.856	1.00
185_A	188_F	0.847	1.00
139_I	146_V	0.842	1.00
191_L	194_I	0.841	1.00
183_Y	186_Y	0.836	1.00
143_L	170_E	0.834	1.00
88_T	91_V	0.830	1.00
166_L	225_M	0.829	1.00
54_F	57_D	0.827	1.00
133_T	161_K	0.825	1.00
201_D	204_S	0.824	1.00
102_K	106_E	0.822	1.00
222_K	233_V	0.821	1.00
33_A	100_M	0.817	1.00
144_R	170_E	0.808	1.00
170_E	221_L	0.808	1.00
142_G	146_V	0.803	1.00
108_L	117_V	0.799	1.00
133_T	159_V	0.798	1.00
47_I	50_L	0.797	1.00
179_L	182_A	0.781	1.00
157_Y	228_A	0.777	1.00
133_T	158_R	0.772	1.00
71_A	146_V	0.771	1.00
107_K	111_I	0.764	1.00
186_Y	190_V	0.762	1.00
182_A	186_Y	0.759	1.00
26_A	121_Q	0.758	1.00
224_M	228_A	0.757	1.00
189_H	194_I	0.752	1.00
143_L	152_A	0.751	1.00
124_A	146_V	0.745	1.00
136_C	164_G	0.742	1.00
103_M	107_K	0.742	1.00
173_K	217_D	0.740	1.00
219_D	222_K	0.739	1.00
46_G	49_R	0.735	1.00
65_Q	135_D	0.722	1.00
45_F	48_H	0.713	1.00
70_L	152_A	0.713	1.00
206_R	210_E	0.712	1.00
166_L	230_F	0.707	1.00
44_S	47_I	0.704	1.00
183_Y	187_S	0.702	1.00
134_F	159_V	0.702	1.00
226_Q	233_V	0.696	1.00
24_M	27_H	0.696	1.00
58_C	234_D	0.696	1.00
192_P	195_G	0.695	1.00
41_D	49_R	0.694	1.00
74_T	107_K	0.693	1.00
100_M	141_F	0.691	1.00
91_V	117_V	0.689	1.00
219_D	235_Y	0.685	1.00
68_L	159_V	0.684	1.00
205_Y	208_L	0.676	1.00
108_L	113_V	0.670	1.00
218_Q	235_Y	0.670	1.00
25_V	126_A	0.669	1.00
44_S	48_H	0.667	0.99
98_E	105_R	0.666	0.99
45_F	49_R	0.663	0.99
30_H	98_E	0.663	0.99
145_N	211_S	0.662	0.99
79_A	82_S	0.660	0.99
132_N	162_P	0.658	0.99
34_S	103_M	0.654	0.99
66_T	132_N	0.653	0.99
95_D	100_M	0.650	0.99
189_H	193_R	0.649	0.99
131_D	159_V	0.647	0.99
181_K	184_D	0.646	0.99
196_S	199_A	0.642	0.99
41_D	48_H	0.637	0.99
71_A	96_I	0.636	0.99
126_A	155_S	0.633	0.99
79_A	119_Y	0.630	0.99
151_K	155_S	0.629	0.99
154_R	228_A	0.625	0.99
180_S	183_Y	0.624	0.99
141_F	169_L	0.619	0.99
206_R	209_A	0.617	0.99
215_H	221_L	0.615	0.99
93_L	117_V	0.614	0.99
68_L	94_A	0.613	0.99
105_R	119_Y	0.608	0.99
144_R	169_L	0.606	0.99
27_H	31_S	0.606	0.99
140_S	169_L	0.604	0.99
184_D	187_S	0.598	0.99
74_T	103_M	0.598	0.99
219_D	223_A	0.597	0.99
132_N	158_R	0.594	0.99
113_V	117_V	0.594	0.99
29_F	33_A	0.593	0.99
125_E	152_A	0.591	0.99
69_D	145_N	0.588	0.99
29_F	144_R	0.588	0.99
46_G	50_L	0.586	0.99
198_V	202_A	0.585	0.99
203_D	206_R	0.583	0.99
67_V	138_T	0.582	0.99
77_L	80_K	0.582	0.99
226_Q	232_S	0.580	0.99
158_R	161_K	0.580	0.99
198_V	201_D	0.577	0.99
141_F	171_F	0.575	0.99
48_H	52_K	0.575	0.99
182_A	191_L	0.575	0.99
220_T	224_M	0.573	0.98
64_G	135_D	0.573	0.98
154_R	158_R	0.572	0.98
60_G	165_R	0.571	0.98
28_V	32_V	0.567	0.98
188_F	192_P	0.567	0.98
39_M	43_M	0.566	0.98
58_C	61_V	0.566	0.98
205_Y	210_E	0.564	0.98
216_P	220_T	0.562	0.98
153_L	228_A	0.559	0.98
82_S	91_V	0.558	0.98
56_I	84_L	0.557	0.98
224_M	227_D	0.554	0.98
105_R	118_E	0.552	0.98
96_I	125_E	0.547	0.98
27_H	30_H	0.546	0.98
63_R	88_T	0.545	0.98
69_D	138_T	0.544	0.98
213_R	216_P	0.541	0.98
179_L	186_Y	0.540	0.98
143_L	168_V	0.539	0.98
47_I	51_W	0.537	0.98
168_V	225_M	0.537	0.98
189_H	192_P	0.535	0.98
132_N	161_K	0.531	0.98
59_S	167_L	0.530	0.97
153_L	168_V	0.529	0.97
193_R	202_A	0.529	0.97
58_C	167_L	0.528	0.97
44_S	51_W	0.528	0.97
186_Y	189_H	0.525	0.97
190_V	193_R	0.524	0.97
136_C	165_R	0.524	0.97
179_L	183_Y	0.523	0.97
94_A	129_F	0.521	0.97
108_L	112_G	0.520	0.97
186_Y	192_P	0.519	0.97
64_G	136_C	0.519	0.97
131_D	155_S	0.519	0.97
38_V	42_L	0.519	0.97
194_I	197_L	0.518	0.97
137_I	164_G	0.515	0.97
148_D	154_R	0.514	0.97
40_N	145_N	0.514	0.97
67_V	89_G	0.514	0.97
195_G	200_N	0.512	0.97
29_F	145_N	0.511	0.97
128_P	159_V	0.510	0.97
108_L	116_N	0.509	0.97
107_K	110_N	0.509	0.97
43_M	171_F	0.509	0.97
156_M	168_V	0.505	0.97
56_I	81_F	0.505	0.97
185_A	190_V	0.504	0.97
199_A	203_D	0.503	0.97
72_G	95_D	0.503	0.97
180_S	189_H	0.502	0.97
187_S	212_I	0.502	0.97
133_T	162_P	0.500	0.96
153_L	225_M	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4obxA	2	0.8765	100	0.369	Contact Map
4pneA	2	0.8486	100	0.448	Contact Map
2o57A	2	0.8367	100	0.46	Contact Map
3bkxA	2	0.8685	100	0.461	Contact Map
3dtnA	2	0.8725	100	0.464	Contact Map
1vl5A	1	0.7211	100	0.478	Contact Map
4kdcA	1	0.8008	100	0.479	Contact Map
3hemA	2	0.8566	100	0.48	Contact Map
3dlcA	1	0.8606	100	0.481	Contact Map
1y8cA	1	0.8645	100	0.481	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0086 seconds.