PSIE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PSIE - Protein PsiE

UniProt:	P0A7C8	Sequences: MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEGLVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILLLVITLWLCNSKRLKRE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11209
Length:	136 (123)
Sequences:	187 (127)
Seq/√Len:	11.4

ECOLI - PSIE
BACSU - PSIE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
116_A	120_L	4.867	1.00
29_L	33_V	2.942	0.94
73_L	125_L	2.774	0.92
24_L	85_P	2.514	0.88
73_L	80_S	2.385	0.85
59_E	122_V	2.286	0.82
78_F	91_Y	2.264	0.82
97_I	121_L	2.227	0.81
45_V	58_V	2.212	0.80
77_Y	92_I	2.104	0.77
42_L	114_Y	2.079	0.76
69_E	105_H	2.042	0.74
67_Y	101_I	1.981	0.72
17_Q	129_N	1.920	0.69
39_T	73_L	1.878	0.68
85_P	88_Y	1.831	0.66
70_F	118_I	1.826	0.65
84_F	102_I	1.824	0.65
78_F	103_V	1.768	0.63
77_Y	91_Y	1.699	0.60
13_S	16_L	1.628	0.56
67_Y	76_K	1.613	0.56
103_V	111_V	1.576	0.54
64_Y	68_F	1.574	0.54
67_Y	88_Y	1.525	0.51
55_Y	117_A	1.415	0.46
40_V	122_V	1.393	0.45
54_K	62_V	1.388	0.45
17_Q	20_L	1.388	0.45
124_T	130_S	1.349	0.43
39_T	64_Y	1.342	0.42
97_I	125_L	1.340	0.42
20_L	68_F	1.327	0.42
22_L	123_I	1.325	0.41
90_V	98_V	1.304	0.40
60_G	114_Y	1.293	0.40
90_V	97_I	1.288	0.40
29_L	44_D	1.278	0.39
119_L	129_N	1.259	0.38
28_G	49_P	1.237	0.37
81_G	120_L	1.232	0.37
100_L	114_Y	1.231	0.37
77_Y	84_F	1.198	0.36
84_F	101_I	1.187	0.35
24_L	112_L	1.184	0.35
67_Y	84_F	1.181	0.35
21_N	78_F	1.173	0.34
31_L	102_I	1.170	0.34
20_L	111_V	1.167	0.34
43_A	62_V	1.159	0.34
15_I	115_S	1.143	0.33
117_A	125_L	1.138	0.33
90_V	125_L	1.120	0.32
76_K	84_F	1.115	0.32
11_F	127_L	1.114	0.32
87_R	119_L	1.109	0.32
24_L	74_I	1.106	0.32
34_F	60_G	1.106	0.32
84_F	91_Y	1.103	0.31
49_P	61_L	1.090	0.31
78_F	82_F	1.090	0.31
97_I	128_C	1.086	0.31
52_T	120_L	1.045	0.29
78_F	84_F	1.039	0.29
29_L	109_L	0.983	0.27
26_C	112_L	0.983	0.27
53_S	114_Y	0.971	0.26
77_Y	88_Y	0.960	0.26
76_K	85_P	0.958	0.26
57_L	64_Y	0.941	0.25
65_F	96_A	0.939	0.25
29_L	56_E	0.921	0.24
33_V	40_V	0.920	0.24
112_L	127_L	0.904	0.24
72_A	119_L	0.892	0.23
62_V	81_G	0.890	0.23
66_L	102_I	0.890	0.23
24_L	88_Y	0.884	0.23
78_F	101_I	0.877	0.23
23_G	113_I	0.876	0.23
73_L	89_F	0.865	0.22
56_E	115_S	0.863	0.22
84_F	88_Y	0.862	0.22
76_K	92_I	0.859	0.22
15_I	29_L	0.851	0.22
21_N	84_F	0.843	0.22
106_K	123_I	0.838	0.21
53_S	121_L	0.829	0.21
85_P	95_T	0.824	0.21
12_I	33_V	0.821	0.21
36_G	57_L	0.820	0.21
98_V	124_T	0.809	0.20
78_F	89_F	0.807	0.20
37_K	100_L	0.803	0.20
58_V	125_L	0.797	0.20
26_C	52_T	0.797	0.20
61_L	71_I	0.795	0.20
16_L	28_G	0.795	0.20
107_S	112_L	0.792	0.20
32_V	106_K	0.791	0.20
77_Y	85_P	0.781	0.20
42_L	60_G	0.770	0.19
26_C	43_A	0.770	0.19
38_E	63_V	0.762	0.19
55_Y	80_S	0.759	0.19
97_I	117_A	0.757	0.19
27_L	39_T	0.753	0.19
14_T	22_L	0.748	0.19
19_V	103_V	0.743	0.18
22_L	109_L	0.743	0.18
32_V	107_S	0.742	0.18
41_H	124_T	0.729	0.18
76_K	91_Y	0.726	0.18
68_F	72_A	0.722	0.18
119_L	123_I	0.722	0.18
47_F	61_L	0.720	0.18
9_V	115_S	0.719	0.18
16_L	104_D	0.711	0.18
76_K	82_F	0.704	0.17
30_I	39_T	0.703	0.17
79_Q	116_A	0.702	0.17
10_E	29_L	0.692	0.17
108_P	114_Y	0.687	0.17
123_I	128_C	0.687	0.17
90_V	128_C	0.684	0.17
18_T	22_L	0.683	0.17
69_E	76_K	0.675	0.17
99_R	118_I	0.673	0.16
35_L	63_V	0.666	0.16
69_E	96_A	0.654	0.16
83_H	99_R	0.652	0.16
52_T	56_E	0.650	0.16
27_L	114_Y	0.648	0.16
29_L	120_L	0.642	0.16
36_G	40_V	0.640	0.16
10_E	43_A	0.638	0.16
56_E	127_L	0.635	0.15
19_V	109_L	0.631	0.15
89_F	111_V	0.624	0.15
80_S	125_L	0.621	0.15
73_L	86_L	0.619	0.15
39_T	80_S	0.617	0.15
114_Y	121_L	0.612	0.15
34_F	127_L	0.605	0.15
22_L	27_L	0.602	0.15
69_E	97_I	0.599	0.15
15_I	19_V	0.594	0.14
77_Y	103_V	0.590	0.14
46_L	79_Q	0.586	0.14
16_L	82_F	0.586	0.14
51_Q	109_L	0.579	0.14
82_F	91_Y	0.575	0.14
34_F	46_L	0.568	0.14
91_Y	101_I	0.568	0.14
21_N	124_T	0.567	0.14
22_L	53_S	0.566	0.14
45_V	50_E	0.562	0.14
77_Y	82_F	0.556	0.14
82_F	103_V	0.555	0.14
42_L	113_I	0.553	0.13
89_F	105_H	0.550	0.13
27_L	131_K	0.546	0.13
106_K	131_K	0.544	0.13
34_F	64_Y	0.544	0.13
45_V	60_G	0.541	0.13
67_Y	78_F	0.541	0.13
74_I	102_I	0.539	0.13
81_G	127_L	0.535	0.13
22_L	43_A	0.535	0.13
27_L	36_G	0.533	0.13
86_L	93_G	0.527	0.13
80_S	85_P	0.524	0.13
75_V	103_V	0.522	0.13
73_L	128_C	0.516	0.13
18_T	57_L	0.516	0.13
39_T	60_G	0.515	0.13
40_V	43_A	0.512	0.13
33_V	79_Q	0.510	0.13
36_G	126_W	0.509	0.13
52_T	116_A	0.503	0.12
88_Y	92_I	0.502	0.12
32_V	36_G	0.502	0.12
64_Y	73_L	0.501	0.12
33_V	57_L	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hw9A	3	0.6765	9.9	0.946	Contact Map
1rklA	1	0.2647	9.3	0.947	Contact Map
3l1lA	2	0.9118	7.2	0.95	Contact Map
2latA	1	0.2647	7	0.95	Contact Map
3m73A	3	0.4485	5.4	0.953	Contact Map
2kluA	1	0.2426	3.4	0.957	Contact Map
2ww9B	1	0.4412	3.1	0.958	Contact Map
3j2wE	1	0.3382	2.9	0.959	Contact Map
3j5pB	3	0.9265	2.7	0.959	Contact Map
2mfrA	1	0.2941	2.4	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.