KEFG - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

KEFG - Glutathione-regulated potassium-efflux system ancillary protein KefG

UniProt:	P0A756	Sequences: MMSQPAKVLLLYAHPESQDSVANRVLLKPATQLSNVTVHDLYAHYPDFFIDIPREQALLREHEVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLAGKYWRSVITTGEPESAYRYDALNRYPMSDVLRPFELAAGMCRMHWLSPIIIYWARRQSAQELASHARAYGDWLANPLSPGGR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12902
Length:	184 (167)
Sequences:	3750 (2695)
Seq/√Len:	208.5

ECOLI - KEFG KEFF YCAK MDAB AZOR
BACSU - YDEQ GS14 YRKL AZOR2 AZOR1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_T	61_E	3.719	1.00
82_E	86_R	2.502	1.00
13_A	79_L	2.395	1.00
39_H	58_L	2.373	1.00
40_D	43_A	2.373	1.00
7_K	35_N	2.358	1.00
56_Q	92_F	2.152	1.00
37_T	58_L	2.104	1.00
106_W	140_A	2.044	1.00
71_L	110_I	2.003	1.00
12_Y	23_N	1.989	1.00
39_H	44_H	1.973	1.00
57_A	61_E	1.968	1.00
64_V	105_Y	1.903	1.00
65_I	145_M	1.902	1.00
8_V	64_V	1.900	1.00
105_Y	146_H	1.896	1.00
53_P	57_A	1.867	1.00
24_R	28_K	1.860	1.00
7_K	61_E	1.834	1.00
60_R	92_F	1.808	1.00
128_P	131_D	1.789	1.00
57_A	60_R	1.774	1.00
27_L	31_T	1.772	1.00
9_L	58_L	1.740	1.00
54_R	58_L	1.731	1.00
81_K	85_D	1.708	1.00
161_A	165_A	1.684	1.00
169_R	172_G	1.662	1.00
160_S	163_E	1.655	1.00
37_T	62_H	1.648	1.00
44_H	58_L	1.643	1.00
13_A	42_Y	1.596	1.00
78_A	82_E	1.594	1.00
28_K	31_T	1.570	1.00
10_L	27_L	1.558	1.00
22_A	111_T	1.554	1.00
68_Q	171_Y	1.544	1.00
55_E	83_W	1.475	1.00
84_L	88_L	1.470	1.00
163_E	166_S	1.443	1.00
109_V	171_Y	1.437	1.00
29_P	172_G	1.425	1.00
28_K	32_Q	1.396	1.00
167_H	170_A	1.380	1.00
102_A	144_R	1.364	1.00
56_Q	93_A	1.353	1.00
25_V	29_P	1.352	1.00
9_L	62_H	1.342	1.00
39_H	55_E	1.335	1.00
159_Q	164_L	1.320	1.00
44_H	54_R	1.310	1.00
166_S	170_A	1.307	1.00
8_V	34_S	1.305	1.00
99_N	102_A	1.302	1.00
23_N	38_V	1.294	1.00
68_Q	109_V	1.281	1.00
52_I	56_Q	1.278	1.00
95_G	98_G	1.277	1.00
165_A	169_R	1.276	1.00
54_R	57_A	1.268	1.00
29_P	32_Q	1.263	1.00
106_W	145_M	1.257	1.00
151_I	170_A	1.243	1.00
129_M	152_I	1.237	1.00
71_L	129_M	1.234	1.00
42_Y	79_L	1.199	1.00
51_D	54_R	1.192	1.00
153_I	159_Q	1.182	1.00
140_A	145_M	1.180	1.00
131_D	134_R	1.160	1.00
13_A	80_L	1.152	1.00
116_E	154_Y	1.141	1.00
109_V	151_I	1.116	1.00
171_Y	175_L	1.098	1.00
44_H	55_E	1.097	1.00
164_L	168_A	1.095	1.00
29_P	33_L	1.094	1.00
29_P	176_A	1.091	1.00
66_V	107_R	1.087	1.00
27_L	38_V	1.084	1.00
76_C	80_L	1.081	1.00
103_G	146_H	1.081	1.00
26_L	30_A	1.079	1.00
48_F	82_E	1.077	1.00
25_V	28_K	1.075	1.00
25_V	172_G	1.073	1.00
112_T	154_Y	1.072	1.00
62_H	65_I	1.063	1.00
138_L	141_G	1.062	1.00
101_L	145_M	1.051	1.00
116_E	120_R	1.049	1.00
169_R	173_D	1.045	1.00
171_Y	174_W	1.033	1.00
88_L	143_C	1.030	1.00
69_H	108_S	1.029	1.00
95_G	100_Q	1.008	1.00
63_E	104_K	1.006	1.00
11_L	39_H	1.005	1.00
58_L	61_E	0.999	1.00
21_V	161_A	0.998	1.00
32_Q	172_G	0.986	1.00
53_P	56_Q	0.984	1.00
73_T	85_D	0.954	0.99
12_Y	20_S	0.951	0.99
13_A	41_L	0.945	0.99
153_I	167_H	0.942	0.99
134_R	137_E	0.932	0.99
46_P	49_F	0.931	0.99
46_P	82_E	0.929	0.99
60_R	100_Q	0.904	0.99
56_Q	89_S	0.902	0.99
35_N	61_E	0.897	0.99
31_T	35_N	0.881	0.99
74_Y	142_M	0.873	0.99
115_P	118_A	0.867	0.99
149_S	174_W	0.862	0.99
59_L	65_I	0.861	0.99
7_K	63_E	0.847	0.99
20_S	23_N	0.843	0.99
21_V	168_A	0.841	0.99
114_E	125_N	0.841	0.99
140_A	147_W	0.831	0.99
172_G	176_A	0.826	0.99
109_V	153_I	0.824	0.99
15_P	72_Y	0.824	0.99
105_Y	148_L	0.821	0.98
139_A	143_C	0.821	0.98
110_I	133_L	0.820	0.98
132_V	138_L	0.815	0.98
173_D	176_A	0.812	0.98
112_T	152_I	0.800	0.98
69_H	129_M	0.800	0.98
90_R	96_P	0.799	0.98
112_T	129_M	0.797	0.98
110_I	152_I	0.792	0.98
159_Q	163_E	0.791	0.98
45_Y	50_I	0.781	0.98
39_H	83_W	0.780	0.98
26_L	171_Y	0.779	0.98
107_R	174_W	0.777	0.98
84_L	139_A	0.768	0.98
71_L	132_V	0.767	0.98
78_A	86_R	0.765	0.98
16_E	19_D	0.764	0.98
73_T	94_S	0.761	0.98
98_G	102_A	0.756	0.97
33_L	176_A	0.738	0.97
23_N	68_Q	0.736	0.97
107_R	151_I	0.732	0.97
19_D	82_E	0.732	0.97
59_L	83_W	0.730	0.97
71_L	119_Y	0.725	0.97
166_S	169_R	0.725	0.97
90_R	94_S	0.720	0.97
10_L	66_V	0.719	0.97
64_V	107_R	0.719	0.97
28_K	172_G	0.719	0.97
67_F	140_A	0.717	0.96
118_A	124_L	0.717	0.96
21_V	164_L	0.712	0.96
17_S	43_A	0.707	0.96
51_D	55_E	0.703	0.96
170_A	173_D	0.701	0.96
59_L	67_F	0.699	0.96
69_H	110_I	0.699	0.96
9_L	39_H	0.691	0.96
26_L	109_V	0.690	0.96
53_P	166_S	0.686	0.95
25_V	165_A	0.684	0.95
11_L	67_F	0.682	0.95
55_E	58_L	0.679	0.95
46_P	50_I	0.671	0.95
10_L	26_L	0.671	0.95
112_T	119_Y	0.669	0.95
99_N	144_R	0.669	0.95
15_P	19_D	0.668	0.95
168_A	172_G	0.662	0.95
11_L	83_W	0.655	0.94
93_A	101_L	0.651	0.94
7_K	40_D	0.650	0.94
151_I	171_Y	0.649	0.94
13_A	40_D	0.642	0.94
164_L	167_H	0.642	0.94
21_V	25_V	0.638	0.93
46_P	86_R	0.637	0.93
69_H	133_L	0.625	0.93
22_A	109_V	0.623	0.93
48_F	89_S	0.622	0.92
69_H	80_L	0.622	0.92
151_I	174_W	0.617	0.92
25_V	168_A	0.616	0.92
114_E	155_W	0.616	0.92
131_D	137_E	0.615	0.92
124_L	142_M	0.615	0.92
59_L	88_L	0.613	0.92
125_N	138_L	0.611	0.92
162_Q	166_S	0.606	0.92
106_W	147_W	0.605	0.91
49_F	82_E	0.604	0.91
56_Q	87_V	0.603	0.91
26_L	167_H	0.599	0.91
26_L	153_I	0.597	0.91
20_S	24_R	0.596	0.91
105_Y	144_R	0.596	0.91
69_H	76_C	0.593	0.91
79_L	83_W	0.593	0.91
56_Q	90_R	0.588	0.90
77_P	85_D	0.586	0.90
69_H	77_P	0.585	0.90
50_I	54_R	0.583	0.90
30_A	171_Y	0.575	0.89
76_C	84_L	0.572	0.89
110_I	129_M	0.571	0.89
156_A	164_L	0.570	0.89
12_Y	17_S	0.569	0.89
119_Y	123_A	0.564	0.88
74_Y	138_L	0.563	0.88
91_G	95_G	0.563	0.88
126_R	138_L	0.560	0.88
10_L	36_V	0.555	0.88
80_L	84_L	0.548	0.87
98_G	101_L	0.543	0.86
66_V	171_Y	0.541	0.86
137_E	150_P	0.539	0.86
7_K	37_T	0.537	0.86
67_F	80_L	0.535	0.86
49_F	86_R	0.535	0.86
134_R	138_L	0.534	0.85
160_S	164_L	0.534	0.85
34_S	64_V	0.533	0.85
86_R	89_S	0.532	0.85
74_Y	114_E	0.531	0.85
12_Y	27_L	0.531	0.85
168_A	171_Y	0.528	0.85
130_S	137_E	0.528	0.85
96_P	143_C	0.526	0.85
108_S	133_L	0.525	0.85
18_Q	24_R	0.520	0.84
31_T	36_V	0.514	0.83
105_Y	147_W	0.510	0.83
29_P	175_L	0.508	0.83
74_Y	125_N	0.508	0.83
169_R	176_A	0.507	0.82
121_Y	131_D	0.506	0.82
12_Y	42_Y	0.505	0.82
44_H	49_F	0.504	0.82
36_V	41_L	0.503	0.82
107_R	149_S	0.502	0.82
130_S	150_P	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1d4aA	2	0.9783	100	0.378	Contact Map
4gi5A	2	0.9837	100	0.394	Contact Map
3l9wA	2	0.9511	100	0.406	Contact Map
4fglA	2	0.9837	100	0.436	Contact Map
3f2vA	2	0.9239	100	0.442	Contact Map
2amjA	2	0.9022	100	0.447	Contact Map
3rpeA	2	0.9293	100	0.449	Contact Map
3ha2A	2	0.8967	100	0.463	Contact Map
3lcmA	2	0.9402	100	0.481	Contact Map
4r81A	4	0.962	100	0.485	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.