MSCL - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MSCL - Large-conductance mechanosensitive channel

UniProt:	P0A742	Sequences: MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11180
Length:	136 (123)
Sequences:	2898 (1864)
Seq/√Len:	168.1

ECOLI - MSCL
BACSU - MSCL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_S	38_A	3.641	1.00
5_K	9_E	3.367	1.00
117_K	120_V	2.982	1.00
6_E	97_K	2.646	1.00
6_E	93_F	2.370	1.00
90_F	94_M	2.332	1.00
31_K	34_S	2.266	1.00
6_E	100_N	2.169	1.00
117_K	123_T	2.092	1.00
30_G	34_S	2.021	1.00
74_H	77_V	1.953	1.00
57_F	75_Y	1.932	1.00
17_V	99_I	1.932	1.00
35_S	39_D	1.919	1.00
3_I	94_M	1.916	1.00
39_D	77_V	1.871	1.00
116_T	119_E	1.831	1.00
36_L	40_I	1.735	1.00
58_A	72_V	1.700	1.00
114_A	120_V	1.698	1.00
19_L	23_V	1.667	1.00
103_N	106_K	1.646	1.00
40_I	73_M	1.617	1.00
23_V	30_G	1.571	1.00
3_I	90_F	1.547	1.00
36_L	78_F	1.524	1.00
118_E	121_L	1.520	1.00
93_F	97_K	1.500	1.00
116_T	120_V	1.487	1.00
120_V	123_T	1.476	1.00
94_M	98_L	1.432	1.00
84_D	88_V	1.431	1.00
31_K	84_D	1.426	1.00
11_A	89_A	1.411	1.00
19_L	22_G	1.410	1.00
9_E	104_R	1.403	1.00
115_P	120_V	1.386	1.00
77_V	81_N	1.375	1.00
80_Q	84_D	1.370	1.00
58_A	70_A	1.320	1.00
115_P	123_T	1.287	1.00
44_P	73_M	1.272	1.00
54_F	79_I	1.243	1.00
124_E	130_K	1.234	1.00
128_L	131_E	1.231	1.00
105_K	108_E	1.184	1.00
123_T	128_L	1.171	1.00
103_N	107_E	1.169	1.00
11_A	86_L	1.156	1.00
46_G	54_F	1.127	1.00
58_A	74_H	1.126	1.00
34_S	37_V	1.119	1.00
27_A	31_K	1.089	1.00
32_I	82_V	1.080	1.00
115_P	119_E	1.072	1.00
124_E	127_D	1.033	0.99
34_S	84_D	1.022	0.99
51_G	57_F	1.013	0.99
16_V	36_L	1.008	0.99
119_E	123_T	1.008	0.99
7_F	89_A	1.007	0.99
104_R	108_E	1.006	0.99
58_A	68_I	1.006	0.99
39_D	78_F	1.002	0.99
60_T	71_V	0.995	0.99
7_F	90_F	0.989	0.99
117_K	124_E	0.984	0.99
115_P	124_E	0.977	0.99
24_I	95_A	0.976	0.99
92_I	95_A	0.975	0.99
104_R	107_E	0.952	0.99
122_L	126_R	0.950	0.99
60_T	72_V	0.940	0.99
39_D	81_N	0.937	0.99
16_V	23_V	0.935	0.99
13_R	103_N	0.926	0.99
98_L	102_L	0.907	0.98
17_V	95_A	0.907	0.98
58_A	69_P	0.875	0.98
46_G	71_V	0.875	0.98
116_T	121_L	0.865	0.98
35_S	77_V	0.860	0.98
100_N	103_N	0.856	0.98
39_D	74_H	0.856	0.98
40_I	78_F	0.850	0.98
119_E	128_L	0.847	0.97
42_M	46_G	0.833	0.97
15_N	18_D	0.833	0.97
24_I	91_A	0.828	0.97
49_I	57_F	0.825	0.97
41_I	87_I	0.812	0.97
47_L	61_L	0.812	0.97
44_P	48_L	0.804	0.97
4_I	86_L	0.803	0.97
42_M	80_Q	0.792	0.96
109_P	113_P	0.782	0.96
24_I	37_V	0.770	0.96
101_K	105_K	0.768	0.96
118_E	123_T	0.766	0.95
23_V	27_A	0.762	0.95
42_M	54_F	0.750	0.95
118_E	128_L	0.749	0.95
54_F	83_F	0.747	0.95
42_M	45_L	0.747	0.95
35_S	78_F	0.736	0.94
109_P	112_A	0.731	0.94
44_P	49_I	0.725	0.94
53_D	56_Q	0.721	0.94
60_T	70_A	0.720	0.94
86_L	90_F	0.718	0.94
25_I	92_I	0.712	0.93
16_V	32_I	0.712	0.93
30_G	91_A	0.710	0.93
59_V	73_M	0.708	0.93
98_L	101_K	0.706	0.93
21_V	96_I	0.702	0.93
112_A	115_P	0.701	0.93
121_L	126_R	0.699	0.93
111_A	114_A	0.697	0.93
9_E	100_N	0.697	0.93
80_Q	88_V	0.689	0.92
26_G	99_I	0.687	0.92
96_I	100_N	0.685	0.92
12_M	16_V	0.684	0.92
93_F	98_L	0.682	0.92
38_A	42_M	0.671	0.91
11_A	22_G	0.668	0.91
78_F	82_V	0.668	0.91
58_A	61_L	0.663	0.91
54_F	80_Q	0.653	0.90
37_V	42_M	0.652	0.90
117_K	128_L	0.651	0.90
83_F	87_I	0.646	0.89
116_T	123_T	0.646	0.89
5_K	8_R	0.637	0.89
30_G	88_V	0.637	0.89
30_G	33_V	0.632	0.88
24_I	45_L	0.631	0.88
55_K	80_Q	0.630	0.88
102_L	106_K	0.630	0.88
41_I	91_A	0.629	0.88
46_G	76_G	0.629	0.88
46_G	49_I	0.620	0.88
49_I	52_I	0.619	0.87
87_I	90_F	0.613	0.87
59_V	75_Y	0.608	0.86
18_D	26_G	0.603	0.86
57_F	60_T	0.603	0.86
75_Y	79_I	0.597	0.85
7_F	11_A	0.594	0.85
61_L	70_A	0.586	0.84
46_G	51_G	0.586	0.84
101_K	104_R	0.583	0.84
79_I	83_F	0.582	0.84
81_N	84_D	0.569	0.83
99_I	103_N	0.568	0.83
21_V	92_I	0.568	0.83
50_G	55_K	0.565	0.82
115_P	118_E	0.563	0.82
114_A	117_K	0.562	0.82
95_A	98_L	0.559	0.82
24_I	88_V	0.554	0.81
13_R	18_D	0.544	0.80
22_G	92_I	0.542	0.80
41_I	95_A	0.542	0.80
18_D	22_G	0.539	0.79
126_R	130_K	0.539	0.79
13_R	16_V	0.539	0.79
26_G	30_G	0.535	0.79
48_L	51_G	0.528	0.78
19_L	25_I	0.528	0.78
17_V	21_V	0.527	0.78
58_A	75_Y	0.526	0.78
68_I	72_V	0.523	0.77
22_G	100_N	0.522	0.77
120_V	128_L	0.520	0.77
50_G	54_F	0.519	0.77
55_K	77_V	0.512	0.76
57_F	79_I	0.510	0.75
113_P	116_T	0.510	0.75
50_G	80_Q	0.510	0.75
25_I	29_F	0.506	0.75
52_I	57_F	0.504	0.75
110_A	114_A	0.500	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2oarA	7	0.9044	100	0.135	Contact Map
3hzqA	3	0.6765	100	0.3	Contact Map
4lkuA	3	0.2132	96.4	0.862	Contact Map
2kluA	1	0.4191	46	0.927	Contact Map
4h33A	3	0.5882	24.9	0.937	Contact Map
2j69A	1	0.6397	18.7	0.94	Contact Map
2yfvC	1	0.1838	13.6	0.944	Contact Map
3rlbA	1	0.6691	10.7	0.947	Contact Map
4rfsS	1	0.6397	10.2	0.947	Contact Map
4uotA	3	0.1471	9.8	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.