RSMG - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RSMG - Ribosomal RNA small subunit methyltransferase G

UniProt:	P0A6U5	Sequences: MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNKAYNLTSVRDPNEMLVRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFPSEPPFDGVISRAFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEYQVESVVKLQVPALDGERHLVVIKANKI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10376
Length:	207 (189)
Sequences:	3955 (2912)
Seq/√Len:	211.8

ECOLI - RSMG
BACSU - RSMG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
98_L	101_R	3.042	1.00
102_V	119_P	3.000	1.00
58_I	86_V	2.686	1.00
109_Q	117_I	2.610	1.00
70_I	136_V	2.581	1.00
122_S	126_E	2.559	1.00
70_I	95_L	2.403	1.00
93_T	120_V	2.373	1.00
80_G	94_L	2.372	1.00
72_V	151_C	2.343	1.00
30_M	111_E	2.320	1.00
34_W	37_A	2.218	1.00
84_S	116_N	2.164	1.00
93_T	133_F	2.157	1.00
26_A	111_E	2.118	1.00
91_H	118_E	2.077	1.00
68_R	91_H	2.067	1.00
109_Q	119_P	2.063	1.00
45_D	48_E	2.049	1.00
28_V	49_M	1.982	1.00
17_T	20_Q	1.956	1.00
61_A	87_R	1.949	1.00
95_L	127_F	1.937	1.00
30_M	108_V	1.879	1.00
170_E	174_A	1.874	1.00
134_D	156_G	1.851	1.00
19_H	23_Q	1.830	1.00
34_W	38_Y	1.828	1.00
106_R	119_P	1.791	1.00
155_P	159_G	1.789	1.00
27_Y	81_I	1.785	1.00
26_A	29_N	1.723	1.00
69_F	92_F	1.715	1.00
143_S	175_L	1.711	1.00
30_M	107_Q	1.648	1.00
97_S	123_R	1.615	1.00
107_Q	111_E	1.614	1.00
151_C	161_F	1.602	1.00
138_S	147_M	1.567	1.00
102_V	121_Q	1.564	1.00
143_S	146_D	1.544	1.00
34_W	107_Q	1.541	1.00
70_I	154_L	1.540	1.00
142_A	146_D	1.532	1.00
74_T	94_L	1.518	1.00
91_H	116_N	1.516	1.00
28_V	54_I	1.491	1.00
83_L	92_F	1.468	1.00
70_I	133_F	1.457	1.00
16_L	86_V	1.446	1.00
107_Q	110_H	1.445	1.00
60_V	164_L	1.442	1.00
25_I	29_N	1.404	1.00
20_Q	23_Q	1.399	1.00
28_V	32_H	1.366	1.00
94_L	117_I	1.348	1.00
144_L	163_A	1.327	1.00
24_L	82_P	1.323	1.00
74_T	80_G	1.321	1.00
99_G	103_R	1.316	1.00
96_D	102_V	1.297	1.00
69_F	137_I	1.282	1.00
104_F	108_V	1.280	1.00
103_R	106_R	1.273	1.00
84_S	117_I	1.264	1.00
32_H	46_P	1.263	1.00
165_K	172_E	1.230	1.00
136_V	155_P	1.198	1.00
94_L	105_L	1.197	1.00
60_V	137_I	1.174	1.00
148_V	180_Y	1.162	1.00
106_R	110_H	1.160	1.00
27_Y	78_L	1.152	1.00
87_R	90_A	1.145	1.00
31_L	49_M	1.130	1.00
69_F	90_A	1.129	1.00
96_D	121_Q	1.128	1.00
169_P	198_H	1.126	1.00
30_M	34_W	1.119	1.00
102_V	106_R	1.118	1.00
59_V	188_L	1.114	1.00
22_N	26_A	1.107	1.00
20_Q	85_I	1.102	1.00
66_G	89_E	1.101	1.00
81_I	117_I	1.099	1.00
84_S	92_F	1.070	1.00
142_A	147_M	1.068	1.00
23_Q	88_P	1.066	1.00
185_V	200_V	1.062	1.00
67_E	135_G	1.056	1.00
145_N	175_L	1.040	1.00
99_G	121_Q	1.037	1.00
83_L	137_I	1.036	1.00
171_D	175_L	1.024	1.00
145_N	149_S	1.019	1.00
187_K	196_E	1.016	1.00
54_I	78_L	1.012	1.00
23_Q	85_I	1.010	1.00
169_P	200_V	0.998	1.00
74_T	105_L	0.986	1.00
135_G	162_Y	0.983	1.00
168_M	171_D	0.979	1.00
106_R	109_Q	0.973	1.00
25_I	50_L	0.970	1.00
18_D	22_N	0.968	1.00
21_K	25_I	0.968	1.00
19_H	22_N	0.966	1.00
174_A	177_P	0.965	1.00
27_Y	105_L	0.962	1.00
30_M	33_K	0.955	1.00
147_M	163_A	0.945	0.99
63_Y	186_V	0.937	0.99
187_K	198_H	0.930	0.99
109_Q	114_L	0.929	0.99
43_V	52_R	0.929	0.99
27_Y	108_V	0.928	0.99
166_G	169_P	0.913	0.99
66_G	135_G	0.912	0.99
50_L	55_L	0.911	0.99
68_R	93_T	0.910	0.99
146_D	149_S	0.908	0.99
33_K	37_A	0.905	0.99
76_P	104_F	0.899	0.99
96_D	119_P	0.897	0.99
16_L	20_Q	0.897	0.99
61_A	83_L	0.893	0.99
101_R	105_L	0.891	0.99
182_V	200_V	0.881	0.99
69_F	135_G	0.876	0.99
127_F	154_L	0.873	0.99
33_K	36_K	0.868	0.99
124_V	141_F	0.868	0.99
81_I	109_Q	0.867	0.99
102_V	105_L	0.860	0.99
72_V	124_V	0.859	0.99
122_S	127_F	0.850	0.99
144_L	165_K	0.848	0.99
38_Y	107_Q	0.845	0.99
93_T	118_E	0.836	0.99
81_I	114_L	0.835	0.99
31_L	41_T	0.831	0.99
27_Y	104_F	0.830	0.99
32_H	49_M	0.829	0.99
57_S	82_P	0.827	0.99
185_V	198_H	0.825	0.99
51_V	193_L	0.822	0.99
74_T	102_V	0.812	0.98
156_G	159_G	0.805	0.98
29_N	32_H	0.798	0.98
72_V	136_V	0.796	0.98
42_S	53_H	0.782	0.98
127_F	133_F	0.780	0.98
43_V	48_E	0.772	0.98
76_P	101_R	0.771	0.98
145_N	179_E	0.770	0.98
68_R	134_D	0.770	0.98
31_L	54_I	0.756	0.98
184_S	187_K	0.755	0.98
84_S	90_A	0.753	0.97
65_Q	87_R	0.751	0.97
95_L	122_S	0.750	0.97
182_V	185_V	0.748	0.97
57_S	78_L	0.747	0.97
39_N	100_K	0.745	0.97
148_V	152_H	0.742	0.97
169_P	173_I	0.739	0.97
141_F	147_M	0.736	0.97
72_V	141_F	0.733	0.97
97_S	121_Q	0.723	0.97
25_I	46_P	0.723	0.97
80_G	117_I	0.720	0.97
68_R	132_P	0.718	0.97
124_V	154_L	0.716	0.97
189_Q	194_D	0.715	0.97
128_P	154_L	0.714	0.97
67_E	90_A	0.712	0.96
136_V	159_G	0.711	0.96
148_V	176_L	0.710	0.96
170_E	187_K	0.710	0.96
28_V	46_P	0.708	0.96
24_L	86_V	0.703	0.96
183_E	186_V	0.701	0.96
160_R	183_E	0.701	0.96
167_Q	196_E	0.693	0.96
17_T	23_Q	0.688	0.96
144_L	200_V	0.688	0.96
57_S	164_L	0.687	0.96
51_V	55_L	0.685	0.96
145_N	176_L	0.683	0.96
144_L	172_E	0.682	0.96
152_H	161_F	0.678	0.95
59_V	164_L	0.678	0.95
64_L	69_F	0.675	0.95
40_L	76_P	0.673	0.95
152_H	180_Y	0.669	0.95
51_V	190_V	0.665	0.95
96_D	105_L	0.662	0.95
85_I	112_L	0.658	0.95
190_V	193_L	0.656	0.94
51_V	192_A	0.655	0.94
131_P	157_E	0.648	0.94
176_L	180_Y	0.648	0.94
22_N	25_I	0.648	0.94
23_Q	26_A	0.647	0.94
152_H	155_P	0.639	0.94
34_W	103_R	0.636	0.94
105_L	119_P	0.632	0.93
124_V	150_W	0.632	0.93
49_M	54_I	0.629	0.93
46_P	49_M	0.627	0.93
26_A	112_L	0.622	0.93
85_I	114_L	0.620	0.93
81_I	108_V	0.617	0.92
97_S	125_E	0.616	0.92
43_V	53_H	0.614	0.92
97_S	101_R	0.612	0.92
34_W	104_F	0.611	0.92
41_T	49_M	0.608	0.92
92_F	116_N	0.607	0.92
48_E	52_R	0.606	0.92
106_R	118_E	0.603	0.92
30_M	104_F	0.603	0.92
27_Y	85_I	0.602	0.92
59_V	199_L	0.602	0.92
67_E	87_R	0.600	0.91
105_L	109_Q	0.600	0.91
72_V	95_L	0.597	0.91
38_Y	76_P	0.596	0.91
38_Y	98_L	0.595	0.91
142_A	150_W	0.592	0.91
103_R	107_Q	0.587	0.91
190_V	197_R	0.585	0.90
60_V	83_L	0.584	0.90
99_G	102_V	0.583	0.90
24_L	54_I	0.580	0.90
28_V	50_L	0.578	0.90
11_D	189_Q	0.576	0.90
46_P	50_L	0.575	0.90
137_I	164_L	0.571	0.89
188_L	199_L	0.570	0.89
58_I	82_P	0.569	0.89
36_K	100_K	0.566	0.89
67_E	134_D	0.566	0.89
150_W	153_H	0.565	0.89
18_D	21_K	0.565	0.89
157_E	160_R	0.563	0.89
68_R	133_F	0.559	0.88
48_E	51_V	0.554	0.88
120_V	127_F	0.550	0.87
128_P	149_S	0.548	0.87
33_K	110_H	0.548	0.87
31_L	76_P	0.546	0.87
147_M	165_K	0.544	0.87
145_N	148_V	0.541	0.87
69_F	83_L	0.541	0.87
72_V	147_M	0.539	0.86
95_L	98_L	0.539	0.86
149_S	179_E	0.534	0.86
41_T	46_P	0.533	0.86
26_A	30_M	0.532	0.86
17_T	86_V	0.531	0.86
54_I	82_P	0.530	0.86
42_S	76_P	0.530	0.86
128_P	153_H	0.529	0.85
54_I	84_S	0.528	0.85
60_V	64_L	0.523	0.85
196_E	199_L	0.523	0.85
27_Y	31_L	0.520	0.84
127_F	130_E	0.519	0.84
167_Q	198_H	0.519	0.84
14_I	86_V	0.518	0.84
155_P	161_F	0.514	0.84
19_H	113_K	0.514	0.84
132_P	156_G	0.512	0.84
166_G	198_H	0.511	0.83
54_I	108_V	0.510	0.83
188_L	197_R	0.510	0.83
38_Y	101_R	0.509	0.83
171_D	174_A	0.507	0.83
136_V	151_C	0.506	0.83
38_Y	42_S	0.506	0.83
151_C	154_L	0.503	0.82
61_A	86_V	0.502	0.82
128_P	131_P	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xdzA	1	0.9952	100	0.574	Contact Map
1jsxA	1	0.9324	99.9	0.576	Contact Map
3g89A	1	0.9469	99.9	0.586	Contact Map
2b3tA	1	0.9469	99.7	0.721	Contact Map
3hp7A	1	0.9807	99.6	0.733	Contact Map
3ocjA	1	0.9807	99.6	0.741	Contact Map
4pwyA	2	0.9275	99.5	0.749	Contact Map
4p7cA	1	0.9903	99.5	0.75	Contact Map
1nv8A	1	0.9227	99.4	0.764	Contact Map
2ozvA	2	0.7246	99.3	0.774	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.