GCSH - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GCSH - Glycine cleavage system H protein

UniProt:	P0A6T9	Sequences: MSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLEDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10371
Length:	129 (121)
Sequences:	3749 (2315)
Seq/√Len:	210.4

ECOLI - GCSH
BACSU - GCSH
HALSA - GCSH
SULSO - GCSH2 GCSH1 GCSH3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
118_D	121_A	4.093	1.00
95_E	98_A	3.575	1.00
77_E	106_K	3.471	1.00
58_C	103_F	2.985	1.00
26_T	104_K	2.773	1.00
80_A	104_K	2.596	1.00
31_E	34_Q	2.146	1.00
19_K	25_Y	2.080	1.00
25_Y	107_A	2.021	1.00
75_S	112_E	2.020	1.00
95_E	99_G	2.013	1.00
119_A	123_E	1.905	1.00
24_T	104_K	1.902	1.00
51_T	108_S	1.861	1.00
51_T	77_E	1.861	1.00
117_L	125_L	1.854	1.00
109_D	112_E	1.770	1.00
88_S	91_L	1.722	1.00
111_S	114_E	1.716	1.00
52_V	72_A	1.715	1.00
8_L	18_R	1.623	1.00
8_L	97_Y	1.620	1.00
18_R	26_T	1.585	1.00
22_D	106_K	1.510	1.00
92_V	102_I	1.505	1.00
59_A	70_I	1.500	1.00
53_S	56_D	1.474	1.00
7_E	18_R	1.472	1.00
74_V	107_A	1.471	1.00
54_A	115_S	1.456	1.00
31_E	35_E	1.451	1.00
84_A	88_S	1.436	1.00
60_V	67_A	1.429	1.00
12_K	125_L	1.412	1.00
47_E	50_A	1.378	1.00
84_A	99_G	1.362	1.00
57_D	69_D	1.356	1.00
24_T	106_K	1.339	1.00
85_L	102_I	1.330	1.00
91_L	100_G	1.303	1.00
17_L	25_Y	1.274	1.00
53_S	75_S	1.270	1.00
58_C	70_I	1.269	1.00
60_V	64_V	1.232	1.00
49_G	77_E	1.214	1.00
45_L	81_V	1.198	1.00
84_A	91_L	1.190	1.00
34_Q	93_N	1.184	1.00
32_H	36_L	1.183	1.00
19_K	107_A	1.150	1.00
52_V	58_C	1.143	1.00
15_E	64_V	1.084	1.00
54_A	112_E	1.081	1.00
24_T	79_V	1.073	1.00
79_V	106_K	1.065	1.00
44_D	60_V	1.065	1.00
83_D	86_S	1.065	1.00
20_E	26_T	1.061	1.00
6_A	120_T	1.049	1.00
27_V	103_F	1.049	1.00
88_S	94_S	1.048	1.00
76_G	105_I	1.037	1.00
9_K	113_L	1.002	1.00
121_A	124_A	0.980	1.00
48_V	81_V	0.971	1.00
41_V	64_V	0.957	1.00
43_V	85_L	0.948	0.99
120_T	123_E	0.942	0.99
74_V	105_I	0.940	0.99
91_L	94_S	0.921	0.99
80_A	83_D	0.920	0.99
20_E	104_K	0.917	0.99
50_A	56_D	0.917	0.99
97_Y	119_A	0.914	0.99
11_S	17_L	0.911	0.99
9_K	114_E	0.898	0.99
45_L	102_I	0.896	0.99
20_E	24_T	0.895	0.99
11_S	30_T	0.884	0.99
6_A	123_E	0.877	0.99
19_K	113_L	0.875	0.99
43_V	61_A	0.852	0.99
29_I	61_A	0.849	0.99
11_S	15_E	0.847	0.99
17_L	74_V	0.847	0.99
70_I	103_F	0.838	0.99
60_V	69_D	0.812	0.98
91_L	99_G	0.810	0.98
109_D	113_L	0.806	0.98
25_Y	74_V	0.803	0.98
13_E	71_Y	0.800	0.98
84_A	87_D	0.799	0.98
72_A	105_I	0.796	0.98
39_D	90_E	0.795	0.98
75_S	108_S	0.792	0.98
19_K	110_E	0.780	0.98
41_V	67_A	0.777	0.98
108_S	112_E	0.775	0.98
31_E	97_Y	0.772	0.98
10_Y	97_Y	0.769	0.98
16_W	28_G	0.760	0.98
85_L	91_L	0.758	0.98
5_P	119_A	0.754	0.97
14_H	38_G	0.752	0.97
48_V	80_A	0.735	0.97
40_M	61_A	0.728	0.97
90_E	94_S	0.724	0.97
13_E	66_A	0.714	0.96
27_V	105_I	0.707	0.96
110_E	114_E	0.706	0.96
5_P	10_Y	0.691	0.96
9_K	118_D	0.684	0.96
34_Q	97_Y	0.681	0.95
107_A	110_E	0.680	0.95
37_L	68_S	0.675	0.95
70_I	102_I	0.671	0.95
52_V	78_I	0.666	0.95
25_Y	113_L	0.660	0.95
21_A	24_T	0.656	0.94
46_P	78_I	0.650	0.94
24_T	80_A	0.644	0.94
46_P	81_V	0.642	0.94
110_E	113_L	0.641	0.94
13_E	55_G	0.632	0.93
10_Y	30_T	0.629	0.93
36_L	63_S	0.628	0.93
5_P	30_T	0.625	0.93
15_E	71_Y	0.619	0.92
83_D	87_D	0.617	0.92
12_K	121_A	0.617	0.92
33_A	68_S	0.613	0.92
120_T	124_A	0.613	0.92
47_E	87_D	0.612	0.92
117_L	121_A	0.608	0.92
65_K	68_S	0.606	0.92
15_E	41_V	0.601	0.91
52_V	75_S	0.599	0.91
94_S	99_G	0.598	0.91
43_V	89_P	0.598	0.91
57_D	66_A	0.594	0.91
40_M	59_A	0.593	0.91
27_V	73_P	0.590	0.91
46_P	63_S	0.586	0.90
18_R	21_A	0.578	0.90
29_I	33_A	0.573	0.89
7_E	119_A	0.573	0.89
32_H	126_L	0.571	0.89
9_K	19_K	0.566	0.89
31_E	93_N	0.565	0.89
63_S	66_A	0.564	0.89
62_E	65_K	0.563	0.88
36_L	68_S	0.563	0.88
48_V	83_D	0.559	0.88
15_E	33_A	0.558	0.88
12_K	115_S	0.555	0.88
57_D	60_V	0.553	0.88
49_G	79_V	0.551	0.87
37_L	66_A	0.548	0.87
25_Y	112_E	0.541	0.86
40_M	60_V	0.539	0.86
24_T	107_A	0.539	0.86
95_E	100_G	0.539	0.86
78_I	103_F	0.537	0.86
40_M	93_N	0.536	0.86
59_A	103_F	0.533	0.86
30_T	96_P	0.524	0.85
9_K	39_D	0.524	0.85
39_D	64_V	0.520	0.84
38_G	68_S	0.519	0.84
41_V	62_E	0.517	0.84
50_A	53_S	0.516	0.84
39_D	42_F	0.513	0.83
68_S	71_Y	0.512	0.83
11_S	116_L	0.511	0.83
109_D	114_E	0.508	0.83
8_L	119_A	0.507	0.83
43_V	91_L	0.506	0.83
42_F	62_E	0.503	0.82
50_A	59_A	0.503	0.82
16_W	93_N	0.502	0.82
78_I	105_I	0.500	0.82
15_E	66_A	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hgbA	1	0.9845	100	0.132	Contact Map
3mxuA	3	0.969	100	0.199	Contact Map
1hpcA	2	0.9845	100	0.217	Contact Map
3a7lA	1	0.9922	100	0.218	Contact Map
3tzuA	2	0.938	100	0.232	Contact Map
3wdnA	1	0.9535	100	0.255	Contact Map
1onlA	1	0.9767	100	0.268	Contact Map
1zkoA	2	0.9845	100	0.282	Contact Map
5a35A	1	0.8682	100	0.328	Contact Map
2dn8A	1	0.7752	96.2	0.862	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.