FABZ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FABZ - 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

UniProt:	P0A6Q6	Sequences: MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11284
Length:	151 (137)
Sequences:	3765 (2091)
Seq/√Len:	178.6

ECOLI - FABZ FABA
BACSU - FABZ YCSD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
103_R	136_K	2.972	1.00
33_E	36_R	2.879	1.00
40_A	73_A	2.747	1.00
69_A	113_M	2.477	1.00
39_R	112_I	2.399	1.00
70_M	113_M	2.377	1.00
96_I	99_A	2.370	1.00
41_V	110_Q	2.367	1.00
98_E	142_T	2.360	1.00
9_Q	12_E	2.340	1.00
66_I	111_M	2.181	1.00
116_T	128_K	2.174	1.00
50_F	61_F	2.135	1.00
132_L	137_V	2.135	1.00
130_V	137_V	2.134	1.00
114_E	132_L	2.028	1.00
99_A	141_A	1.961	1.00
39_R	114_E	1.906	1.00
128_K	142_T	1.875	1.00
118_E	128_K	1.777	1.00
41_V	112_I	1.730	1.00
74_T	127_F	1.691	1.00
66_I	139_C	1.679	1.00
12_E	15_E	1.669	1.00
58_K	104_P	1.655	1.00
30_L	41_V	1.652	1.00
49_P	52_Q	1.648	1.00
132_L	135_G	1.645	1.00
28_R	41_V	1.617	1.00
43_N	110_Q	1.601	1.00
114_E	130_V	1.595	1.00
31_D	39_R	1.589	1.00
36_R	116_T	1.509	1.00
38_L	77_L	1.482	1.00
115_V	129_G	1.478	1.00
37_F	114_E	1.470	1.00
42_K	48_E	1.447	1.00
29_V	76_I	1.417	1.00
33_E	37_F	1.370	1.00
112_I	132_L	1.332	1.00
37_F	116_T	1.325	1.00
31_D	37_F	1.281	1.00
92_Y	104_P	1.251	1.00
21_F	52_Q	1.236	1.00
125_T	145_C	1.224	1.00
29_V	40_A	1.209	1.00
113_M	131_A	1.192	1.00
11_E	14_L	1.174	1.00
61_F	65_L	1.162	1.00
103_R	138_V	1.158	1.00
129_G	143_M	1.155	1.00
26_V	73_A	1.148	1.00
58_K	106_V	1.143	1.00
131_A	139_C	1.132	1.00
102_K	140_E	1.126	1.00
38_L	73_A	1.123	1.00
44_V	61_F	1.116	1.00
11_E	15_E	1.108	1.00
35_G	81_S	1.079	1.00
60_I	92_Y	1.074	1.00
111_M	131_A	1.064	1.00
55_F	63_G	1.060	1.00
94_A	144_M	1.047	1.00
109_D	133_V	1.046	1.00
61_F	69_A	1.041	1.00
67_L	96_I	1.039	1.00
14_L	57_G	1.037	1.00
58_K	90_L	1.036	1.00
74_T	115_V	1.029	0.99
95_G	144_M	1.021	0.99
93_F	96_I	1.019	0.99
105_V	138_V	1.017	0.99
66_I	131_A	1.016	0.99
112_I	135_G	1.009	0.99
30_L	112_I	0.996	0.99
14_L	46_V	0.994	0.99
10_I	46_V	0.993	0.99
30_L	39_R	0.979	0.99
137_V	140_E	0.977	0.99
70_M	141_A	0.971	0.99
58_K	92_Y	0.958	0.99
12_E	80_K	0.957	0.99
11_E	58_K	0.954	0.99
21_F	47_N	0.934	0.99
67_L	99_A	0.929	0.99
116_T	130_V	0.916	0.99
117_F	125_T	0.904	0.99
16_L	79_F	0.899	0.99
14_L	24_L	0.899	0.99
110_Q	134_D	0.888	0.98
94_A	146_A	0.885	0.98
28_R	43_N	0.883	0.98
120_T	125_T	0.881	0.98
21_F	46_V	0.880	0.98
17_L	75_G	0.875	0.98
97_D	126_R	0.874	0.98
38_L	76_I	0.873	0.98
91_Y	145_C	0.873	0.98
54_H	63_G	0.869	0.98
10_I	14_L	0.867	0.98
130_V	140_E	0.862	0.98
77_L	81_S	0.859	0.98
70_M	139_C	0.844	0.98
118_E	126_R	0.828	0.98
45_S	48_E	0.827	0.98
16_L	76_I	0.826	0.98
94_A	124_L	0.808	0.97
11_E	106_V	0.803	0.97
32_F	38_L	0.800	0.97
86_E	89_E	0.799	0.97
119_K	122_R	0.790	0.97
127_F	145_C	0.784	0.97
97_D	142_T	0.778	0.97
21_F	43_N	0.777	0.96
100_R	144_M	0.773	0.96
32_F	80_K	0.763	0.96
99_A	139_C	0.762	0.96
42_K	45_S	0.756	0.96
54_H	60_I	0.753	0.96
126_R	144_M	0.743	0.95
118_E	142_T	0.740	0.95
105_V	111_M	0.736	0.95
28_R	110_Q	0.732	0.95
79_F	125_T	0.731	0.95
19_H	25_L	0.729	0.95
26_V	76_I	0.726	0.95
25_L	65_L	0.714	0.94
12_E	16_L	0.704	0.94
78_A	125_T	0.695	0.94
44_V	105_V	0.692	0.93
79_F	82_V	0.690	0.93
20_R	56_P	0.689	0.93
102_K	137_V	0.689	0.93
94_A	145_C	0.678	0.93
50_F	65_L	0.677	0.93
14_L	59_P	0.675	0.93
128_K	140_E	0.671	0.92
29_V	73_A	0.664	0.92
44_V	50_F	0.658	0.92
10_I	28_R	0.654	0.91
17_L	20_R	0.653	0.91
54_H	64_V	0.648	0.91
96_I	101_F	0.641	0.91
73_A	77_L	0.629	0.90
55_F	91_Y	0.628	0.90
46_V	50_F	0.627	0.90
19_H	75_G	0.626	0.89
106_V	109_D	0.621	0.89
38_L	74_T	0.620	0.89
53_G	56_P	0.613	0.89
100_R	140_E	0.611	0.88
74_T	129_G	0.610	0.88
34_E	81_S	0.610	0.88
42_K	47_N	0.610	0.88
45_S	108_G	0.608	0.88
120_T	123_G	0.608	0.88
19_H	23_F	0.605	0.88
119_K	126_R	0.603	0.88
86_E	147_R	0.602	0.88
95_G	100_R	0.600	0.87
73_A	113_M	0.599	0.87
67_L	141_A	0.599	0.87
103_R	106_V	0.597	0.87
83_G	87_P	0.596	0.87
77_L	127_F	0.594	0.87
91_Y	127_F	0.594	0.87
53_G	64_V	0.589	0.86
28_R	134_D	0.582	0.86
11_E	57_G	0.581	0.86
46_V	49_P	0.578	0.85
70_M	129_G	0.576	0.85
82_V	86_E	0.575	0.85
47_N	50_F	0.573	0.85
21_F	45_S	0.570	0.85
124_L	144_M	0.566	0.84
55_F	60_I	0.564	0.84
46_V	52_Q	0.556	0.83
53_G	63_G	0.556	0.83
43_N	46_V	0.554	0.83
26_V	113_M	0.552	0.83
16_L	89_E	0.550	0.83
83_G	86_E	0.548	0.82
26_V	40_A	0.543	0.82
78_A	127_F	0.540	0.81
79_F	147_R	0.534	0.81
51_F	107_P	0.531	0.80
10_I	21_F	0.530	0.80
93_F	97_D	0.528	0.80
15_E	57_G	0.522	0.79
112_I	134_D	0.521	0.79
14_L	21_F	0.520	0.79
11_E	59_P	0.520	0.79
117_F	127_F	0.519	0.79
35_G	117_F	0.518	0.79
10_I	59_P	0.517	0.79
43_N	47_N	0.514	0.78
16_L	80_K	0.514	0.78
54_H	59_P	0.513	0.78
27_D	43_N	0.509	0.77
70_M	131_A	0.509	0.77
23_F	64_V	0.508	0.77
61_F	111_M	0.507	0.77
117_F	123_G	0.507	0.77
21_F	28_R	0.502	0.77
32_F	37_F	0.501	0.76
29_V	38_L	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gllA	3	0.9801	100	0.194	Contact Map
1u1zA	3	0.947	100	0.211	Contact Map
2cf2C	2	0.9669	100	0.235	Contact Map
3q62A	2	0.9669	100	0.25	Contact Map
1z6bA	3	0.9272	100	0.26	Contact Map
3d6xA	3	0.9338	100	0.268	Contact Map
4h4gA	3	0.9338	100	0.291	Contact Map
4b0bA	2	0.9536	100	0.305	Contact Map
4i83A	3	0.9536	100	0.311	Contact Map
3esiA	4	0.7947	99.9	0.497	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.