EFPL - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

EFPL - Elongation factor P-like protein

UniProt:	P0A6N8	Sequences: MPRANEIKKGMVLNYNGKLLLVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYVDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTWDGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGLVIQVPEYLSPGEKIRIHIEERRYMGRAD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG12035
Length:	190 (183)
Sequences:	2787 (1323)
Seq/√Len:	97.8

ECOLI - EFPL EFP
BACSU - EFP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
136_E	175_K	3.797	1.00
71_Y	114_D	3.055	1.00
70_R	86_D	2.730	1.00
18_K	45_D	2.583	1.00
157_T	163_V	2.496	1.00
28_Q	38_L	2.492	1.00
106_F	183_R	2.471	1.00
140_T	156_A	2.445	1.00
75_S	92_P	2.416	1.00
171_S	174_E	2.368	1.00
47_R	123_Q	2.358	1.00
164_I	176_I	2.331	1.00
136_E	159_S	2.304	1.00
30_P	33_R	2.237	1.00
177_R	187_G	2.211	1.00
134_D	175_K	2.199	1.00
137_I	176_I	2.169	1.00
105_L	162_L	2.169	1.00
14_N	63_D	2.142	1.00
138_V	157_T	2.052	1.00
139_E	172_P	1.979	1.00
4_A	59_D	1.950	1.00
83_V	94_T	1.922	1.00
134_D	177_R	1.883	1.00
156_A	166_V	1.878	1.00
135_L	158_L	1.845	1.00
136_E	172_P	1.835	1.00
81_E	94_T	1.832	1.00
136_E	173_G	1.762	1.00
73_D	87_K	1.758	1.00
108_P	159_S	1.727	1.00
16_N	54_E	1.726	1.00
72_V	117_V	1.711	1.00
71_Y	116_Q	1.678	1.00
77_V	97_K	1.666	1.00
139_E	157_T	1.656	1.00
15_Y	54_E	1.653	1.00
73_D	114_D	1.590	1.00
87_K	114_D	1.587	1.00
74_F	77_V	1.579	1.00
117_V	124_L	1.553	1.00
14_N	121_D	1.542	1.00
7_I	22_V	1.507	1.00
137_I	170_L	1.505	1.00
138_V	158_L	1.466	1.00
28_Q	33_R	1.464	1.00
57_K	60_D	1.454	1.00
169_Y	185_Y	1.441	1.00
72_V	93_Y	1.438	1.00
77_V	80_N	1.434	1.00
78_D	81_E	1.389	0.99
106_F	162_L	1.370	0.99
152_R	168_E	1.362	0.99
132_T	186_M	1.341	0.99
96_T	99_Q	1.331	0.99
145_K	148_S	1.306	0.99
78_D	94_T	1.301	0.99
135_L	159_S	1.298	0.99
30_P	34_G	1.280	0.99
41_M	56_F	1.267	0.99
13_L	62_V	1.265	0.99
45_D	48_T	1.261	0.99
7_I	62_V	1.252	0.99
76_Y	83_V	1.241	0.99
85_M	92_P	1.240	0.99
131_Q	181_E	1.231	0.99
97_K	104_L	1.220	0.99
13_L	43_F	1.212	0.99
108_P	111_G	1.211	0.99
30_P	38_L	1.196	0.98
82_Y	104_L	1.185	0.98
33_R	38_L	1.183	0.98
170_L	174_E	1.163	0.98
143_G	168_E	1.163	0.98
158_L	176_I	1.150	0.98
135_L	160_T	1.144	0.98
132_T	177_R	1.126	0.98
158_L	178_I	1.117	0.97
105_L	183_R	1.105	0.97
9_K	24_D	1.088	0.97
84_F	100_I	1.076	0.97
19_L	120_W	1.067	0.97
20_L	52_V	1.058	0.96
137_I	172_P	1.056	0.96
77_V	82_Y	1.047	0.96
81_E	96_T	1.045	0.96
137_I	156_A	1.042	0.96
138_V	159_S	1.035	0.96
15_Y	56_F	1.025	0.96
12_V	19_L	1.020	0.96
14_N	120_W	1.018	0.96
25_I	39_Y	1.013	0.95
108_P	175_K	1.013	0.95
4_A	58_G	1.011	0.95
18_K	47_R	1.005	0.95
40_K	55_R	0.991	0.95
4_A	22_V	0.984	0.95
132_T	179_H	0.980	0.95
169_Y	174_E	0.977	0.95
23_K	44_S	0.976	0.94
177_R	186_M	0.975	0.94
140_T	155_P	0.970	0.94
84_F	127_L	0.969	0.94
134_D	189_A	0.951	0.94
164_I	178_I	0.946	0.94
158_L	162_L	0.945	0.93
42_R	53_E	0.937	0.93
119_T	124_L	0.933	0.93
69_R	128_E	0.928	0.93
19_L	65_V	0.927	0.93
179_H	182_E	0.907	0.92
73_D	110_G	0.900	0.92
27_I	39_Y	0.894	0.91
177_R	189_A	0.889	0.91
153_N	165_Q	0.884	0.91
147_A	168_E	0.883	0.91
28_Q	40_K	0.875	0.91
9_K	25_I	0.855	0.90
80_N	97_K	0.855	0.90
77_V	83_V	0.853	0.89
82_Y	97_K	0.852	0.89
19_L	66_T	0.851	0.89
45_D	50_L	0.851	0.89
101_E	104_L	0.850	0.89
14_N	17_G	0.842	0.89
12_V	69_R	0.836	0.88
39_Y	58_G	0.828	0.88
5_N	22_V	0.826	0.88
12_V	65_V	0.825	0.88
70_R	119_T	0.823	0.88
107_M	111_G	0.814	0.87
4_A	7_I	0.814	0.87
144_I	147_A	0.806	0.87
7_I	11_M	0.805	0.87
35_A	53_E	0.803	0.86
95_F	99_Q	0.798	0.86
140_T	144_I	0.796	0.86
82_Y	100_I	0.796	0.86
132_T	189_A	0.795	0.86
100_I	127_L	0.782	0.85
153_N	163_V	0.781	0.85
14_N	65_V	0.780	0.85
19_L	46_V	0.780	0.85
68_T	122_G	0.779	0.85
95_F	124_L	0.776	0.84
147_A	152_R	0.773	0.84
99_Q	123_Q	0.773	0.84
19_L	47_R	0.772	0.84
167_P	185_Y	0.767	0.84
7_I	41_M	0.766	0.84
144_I	168_E	0.758	0.83
78_D	83_V	0.750	0.82
20_L	43_F	0.750	0.82
155_P	165_Q	0.746	0.82
158_L	163_V	0.745	0.82
145_K	149_A	0.740	0.82
65_V	120_W	0.740	0.82
77_V	104_L	0.737	0.81
140_T	172_P	0.734	0.81
29_S	33_R	0.733	0.81
86_D	89_D	0.733	0.81
139_E	163_V	0.727	0.80
174_E	188_R	0.720	0.80
40_K	53_E	0.717	0.79
93_Y	119_T	0.716	0.79
138_V	160_T	0.716	0.79
69_R	118_L	0.711	0.79
72_V	115_M	0.706	0.78
84_F	95_F	0.706	0.78
143_G	156_A	0.705	0.78
119_T	122_G	0.701	0.78
33_R	36_A	0.698	0.78
103_E	126_A	0.698	0.78
13_L	22_V	0.696	0.77
11_M	22_V	0.695	0.77
80_N	95_F	0.690	0.77
24_D	42_R	0.682	0.76
100_I	103_E	0.672	0.75
5_N	9_K	0.671	0.75
67_L	118_L	0.670	0.75
140_T	166_V	0.660	0.74
32_A	36_A	0.659	0.74
25_I	41_M	0.658	0.73
32_A	38_L	0.650	0.72
11_M	64_T	0.650	0.72
46_V	118_L	0.648	0.72
28_Q	36_A	0.641	0.71
3_R	6_E	0.639	0.71
29_S	55_R	0.637	0.71
87_K	90_Y	0.636	0.71
73_D	92_P	0.632	0.70
14_N	19_L	0.630	0.70
141_A	155_P	0.629	0.70
155_P	163_V	0.626	0.70
84_F	115_M	0.624	0.69
108_P	135_L	0.621	0.69
179_H	186_M	0.617	0.69
34_G	40_K	0.615	0.68
19_L	125_L	0.615	0.68
34_G	55_R	0.614	0.68
36_A	58_G	0.613	0.68
42_R	51_K	0.612	0.68
74_F	83_V	0.610	0.68
4_A	62_V	0.607	0.67
5_N	39_Y	0.603	0.67
116_Q	128_E	0.601	0.67
152_R	155_P	0.600	0.66
74_F	104_L	0.600	0.66
27_I	32_A	0.599	0.66
18_K	48_T	0.597	0.66
13_L	54_E	0.596	0.66
4_A	60_D	0.596	0.66
133_V	180_I	0.587	0.65
56_F	95_F	0.584	0.64
54_E	62_V	0.583	0.64
35_A	38_L	0.579	0.64
28_Q	34_G	0.579	0.64
86_D	93_Y	0.577	0.63
28_Q	32_A	0.577	0.63
66_T	122_G	0.576	0.63
105_L	160_T	0.576	0.63
22_V	25_I	0.576	0.63
169_Y	188_R	0.574	0.63
44_S	51_K	0.569	0.62
143_G	155_P	0.569	0.62
69_R	116_Q	0.569	0.62
29_S	34_G	0.567	0.62
46_V	126_A	0.566	0.62
55_R	151_A	0.566	0.62
142_P	149_A	0.563	0.62
26_D	41_M	0.562	0.61
29_S	35_A	0.558	0.61
7_I	59_D	0.557	0.61
85_M	90_Y	0.557	0.61
34_G	38_L	0.555	0.60
19_L	121_D	0.554	0.60
21_L	69_R	0.553	0.60
111_G	130_P	0.551	0.60
29_S	44_S	0.550	0.60
28_Q	35_A	0.547	0.59
118_L	126_A	0.546	0.59
80_N	96_T	0.546	0.59
5_N	62_V	0.546	0.59
141_A	152_R	0.544	0.59
45_D	123_Q	0.544	0.59
143_G	152_R	0.542	0.59
142_P	171_S	0.539	0.58
142_P	156_A	0.538	0.58
73_D	85_M	0.537	0.58
115_M	127_L	0.536	0.58
137_I	174_E	0.536	0.58
133_V	160_T	0.535	0.58
132_T	181_E	0.534	0.58
143_G	147_A	0.533	0.57
150_S	153_N	0.531	0.57
79_G	83_V	0.529	0.57
141_A	153_N	0.529	0.57
111_G	133_V	0.525	0.56
136_E	174_E	0.521	0.56
80_N	98_D	0.521	0.56
20_L	60_D	0.519	0.55
158_L	164_I	0.516	0.55
35_A	57_K	0.514	0.55
13_L	52_V	0.513	0.55
7_I	13_L	0.510	0.54
139_E	189_A	0.509	0.54
102_E	105_L	0.507	0.54
32_A	58_G	0.506	0.54
71_Y	128_E	0.506	0.54
70_R	122_G	0.505	0.53
105_L	163_V	0.504	0.53
86_D	90_Y	0.502	0.53
141_A	171_S	0.501	0.53
75_S	110_G	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3treA	1	0.6789	100	0.06	Contact Map
1ybyA	2	0.9526	100	0.061	Contact Map
3a5zB	1	0.7053	100	0.062	Contact Map
1uebA	1	0.9684	100	0.063	Contact Map
3oyyA	1	0.9684	100	0.063	Contact Map
1bkbA	3	0.6684	100	0.504	Contact Map
1iz6A	1	0.6789	100	0.512	Contact Map
2eifA	1	0.6474	100	0.515	Contact Map
3er0A	1	0.7053	100	0.521	Contact Map
3hksA	1	0.7053	100	0.525	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.