ATPE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ATPE - ATP synthase epsilon chain

UniProt:	P0A6E6	Sequences: MAMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10100
Length:	139 (129)
Sequences:	3021 (1987)
Seq/√Len:	175.0

ECOLI - ATPE
BACSU - ATPE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
99_K	103_E	2.998	1.00
28_G	33_L	2.894	1.00
6_H	20_L	2.512	1.00
100_R	104_E	2.456	1.00
26_V	70_L	2.430	1.00
7_L	21_V	2.384	1.00
8_D	18_S	2.370	1.00
97_E	100_R	2.266	1.00
50_M	131_V	2.164	1.00
104_E	108_S	2.079	1.00
23_K	34_G	2.068	1.00
97_E	101_K	2.036	1.00
93_A	96_M	2.014	1.00
54_V	60_E	1.943	1.00
85_I	128_Q	1.924	1.00
72_V	77_V	1.887	1.00
96_M	99_K	1.848	1.00
33_L	42_L	1.845	1.00
27_T	32_E	1.815	1.00
92_E	96_M	1.766	1.00
5_Y	37_P	1.730	1.00
52_R	60_E	1.701	1.00
27_T	49_G	1.695	1.00
99_K	122_L	1.684	1.00
23_K	54_V	1.638	1.00
91_D	94_R	1.563	1.00
14_Q	89_D	1.557	1.00
96_M	100_R	1.522	1.00
26_V	33_L	1.514	1.00
103_E	107_S	1.503	1.00
94_R	98_A	1.495	1.00
92_E	132_I	1.456	1.00
44_T	70_L	1.449	1.00
93_A	97_E	1.449	1.00
4_T	22_E	1.417	1.00
4_T	20_L	1.415	1.00
8_D	76_N	1.409	1.00
28_G	44_T	1.391	1.00
32_E	47_K	1.387	1.00
92_E	129_L	1.379	1.00
8_D	15_Q	1.366	1.00
22_E	57_H	1.357	1.00
51_I	79_V	1.353	1.00
3_M	38_G	1.347	1.00
23_K	36_Y	1.342	1.00
66_S	83_T	1.333	1.00
111_G	114_D	1.309	1.00
38_G	75_G	1.302	1.00
53_I	63_I	1.290	1.00
51_I	65_L	1.272	1.00
22_E	56_Q	1.265	1.00
61_E	86_R	1.259	1.00
100_R	103_E	1.242	1.00
61_E	88_Q	1.196	1.00
24_I	77_V	1.183	1.00
29_S	45_A	1.179	1.00
119_S	123_A	1.151	1.00
104_E	107_S	1.139	1.00
127_A	131_V	1.114	1.00
63_I	86_R	1.111	1.00
22_E	54_V	1.110	1.00
101_K	121_E	1.097	1.00
42_L	72_V	1.078	1.00
98_A	101_K	1.067	1.00
95_A	99_K	1.059	1.00
113_V	117_Q	1.053	1.00
5_Y	77_V	1.044	1.00
63_I	84_A	1.024	0.99
24_I	51_I	1.008	0.99
86_R	89_D	1.007	0.99
90_L	95_A	1.007	0.99
19_G	56_Q	1.000	0.99
6_H	18_S	0.993	0.99
62_F	87_G	0.979	0.99
25_Q	52_R	0.974	0.99
16_M	63_I	0.974	0.99
112_D	115_Y	0.969	0.99
25_Q	54_V	0.922	0.99
64_Y	127_A	0.914	0.99
85_I	94_R	0.911	0.99
35_I	72_V	0.908	0.99
9_V	63_I	0.906	0.99
27_T	47_K	0.899	0.99
105_H	121_E	0.894	0.98
105_H	108_S	0.893	0.98
43_L	71_E	0.888	0.98
95_A	125_A	0.882	0.98
98_A	102_A	0.860	0.98
25_Q	32_E	0.859	0.98
120_A	124_K	0.845	0.98
26_V	46_I	0.843	0.98
27_T	70_L	0.843	0.98
66_S	82_D	0.839	0.98
64_Y	131_V	0.838	0.98
101_K	105_H	0.825	0.97
118_A	122_L	0.824	0.97
17_F	53_I	0.824	0.97
99_K	126_I	0.814	0.97
126_I	130_R	0.809	0.97
6_H	76_N	0.803	0.97
85_I	90_L	0.792	0.97
15_Q	18_S	0.792	0.97
115_Y	119_S	0.791	0.97
13_E	80_L	0.787	0.97
124_K	128_Q	0.778	0.96
94_R	128_Q	0.778	0.96
102_A	118_A	0.775	0.96
47_K	123_A	0.761	0.96
67_G	81_A	0.756	0.96
7_L	53_I	0.755	0.96
109_S	115_Y	0.753	0.96
20_L	56_Q	0.745	0.95
129_L	132_I	0.745	0.95
21_V	53_I	0.743	0.95
16_M	84_A	0.723	0.94
95_A	128_Q	0.722	0.94
95_A	98_A	0.717	0.94
7_L	77_V	0.706	0.94
94_R	101_K	0.701	0.93
65_L	79_V	0.701	0.93
48_P	127_A	0.693	0.93
10_V	18_S	0.684	0.93
11_S	21_V	0.684	0.93
85_I	98_A	0.683	0.93
9_V	51_I	0.681	0.92
106_I	115_Y	0.672	0.92
125_A	128_Q	0.669	0.92
43_L	73_Q	0.668	0.92
35_I	70_L	0.656	0.91
3_M	37_P	0.652	0.91
16_M	86_R	0.652	0.91
28_G	42_L	0.652	0.91
56_Q	59_H	0.648	0.91
25_Q	34_G	0.640	0.90
53_I	67_G	0.639	0.90
94_R	97_E	0.639	0.90
32_E	52_R	0.637	0.90
62_F	131_V	0.631	0.89
108_S	111_G	0.630	0.89
24_I	53_I	0.609	0.88
103_E	106_I	0.608	0.88
71_E	78_T	0.602	0.87
52_R	62_F	0.602	0.87
110_H	114_D	0.594	0.86
64_Y	90_L	0.593	0.86
4_T	56_Q	0.590	0.86
5_Y	23_K	0.588	0.86
44_T	72_V	0.586	0.86
116_A	120_A	0.586	0.86
56_Q	61_E	0.584	0.85
123_A	126_I	0.583	0.85
117_Q	121_E	0.572	0.84
12_A	48_P	0.569	0.84
10_V	78_T	0.567	0.84
102_A	105_H	0.566	0.84
114_D	117_Q	0.566	0.84
27_T	65_L	0.563	0.83
10_V	15_Q	0.562	0.83
66_S	127_A	0.560	0.83
90_L	132_I	0.558	0.83
22_E	58_G	0.557	0.83
109_S	114_D	0.554	0.82
33_L	44_T	0.548	0.82
106_I	109_S	0.544	0.81
103_E	122_L	0.543	0.81
70_L	77_V	0.541	0.81
24_I	36_Y	0.538	0.80
121_E	124_K	0.538	0.80
25_Q	40_A	0.536	0.80
22_E	59_H	0.532	0.80
13_E	30_E	0.531	0.80
26_V	35_I	0.531	0.80
81_A	84_A	0.529	0.79
50_M	62_F	0.528	0.79
45_A	63_I	0.528	0.79
3_M	22_E	0.527	0.79
67_G	82_D	0.525	0.79
7_L	50_M	0.521	0.78
19_G	53_I	0.520	0.78
114_D	118_A	0.519	0.78
73_Q	78_T	0.518	0.78
108_S	114_D	0.518	0.78
26_V	51_I	0.515	0.78
65_L	84_A	0.513	0.77
12_A	70_L	0.512	0.77
26_V	49_G	0.511	0.77
5_Y	76_N	0.510	0.77
9_V	53_I	0.508	0.77
69_I	75_G	0.506	0.76
123_A	127_A	0.506	0.76
119_S	126_I	0.503	0.76
17_F	61_E	0.502	0.76
116_A	119_S	0.502	0.76
15_Q	76_N	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1aqtA	2	0.9712	100	0.086	Contact Map
2qe7H	1	0.964	100	0.089	Contact Map
2e5yA	2	0.9568	100	0.092	Contact Map
2rq6A	1	0.9712	100	0.126	Contact Map
2w6jH	1	0.5971	100	0.14	Contact Map
2ck3H	1	0.5971	100	0.157	Contact Map
3ziaH	1	0.8849	100	0.182	Contact Map
2xokH	1	0.8489	100	0.215	Contact Map
3hqxA	2	0.6403	24.2	0.923	Contact Map
3eo6A	2	0.6259	12.5	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.