MUTT - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MUTT - 8-oxo-dGTP diphosphatase

UniProt:	P08337	Sequences: MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10626
Length:	129 (119)
Sequences:	4617 (3309)
Seq/√Len:	303.4

ECOLI - MUTT NUDG NUDJ YFCD
BACSU - YVCI MUTT YJHB
HALSA - Q9HS29 Q9HR46
SULSO - Q97WE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_N	17_E	3.306	1.00
55_Q	61_T	2.966	1.00
22_R	101_P	2.667	1.00
45_T	48_Q	2.598	1.00
22_R	100_Q	2.394	1.00
20_I	113_D	2.325	1.00
40_I	49_A	2.262	1.00
106_S	109_G	2.230	1.00
32_K	114_D	2.161	1.00
5_Q	81_T	2.146	1.00
19_F	102_G	2.054	1.00
9_G	50_V	2.035	1.00
54_L	62_P	2.017	1.00
105_M	113_D	1.999	1.00
20_I	115_F	1.979	1.00
20_I	105_M	1.925	1.00
63_Q	88_E	1.815	1.00
24_A	27_A	1.757	1.00
17_E	106_S	1.737	1.00
69_E	125_K	1.718	1.00
26_D	30_A	1.715	1.00
61_T	91_E	1.711	1.00
109_G	112_A	1.660	1.00
12_R	86_L	1.634	1.00
5_Q	83_W	1.545	1.00
60_I	89_R	1.529	1.00
46_P	85_W	1.513	1.00
40_I	46_P	1.493	1.00
59_G	97_K	1.488	1.00
51_V	55_Q	1.452	1.00
7_A	49_A	1.445	1.00
59_G	95_W	1.401	1.00
9_G	54_L	1.387	1.00
74_E	79_H	1.367	1.00
21_T	102_G	1.354	1.00
89_R	92_G	1.331	1.00
65_F	88_E	1.323	1.00
72_E	81_T	1.314	1.00
8_V	84_F	1.296	1.00
63_Q	90_W	1.277	1.00
10_I	68_F	1.237	1.00
24_A	30_A	1.229	1.00
32_K	117_P	1.227	1.00
16_N	107_L	1.202	1.00
103_E	113_D	1.195	1.00
51_V	64_H	1.190	1.00
7_A	46_P	1.177	1.00
21_T	99_G	1.172	1.00
70_K	81_T	1.163	1.00
11_I	54_L	1.151	1.00
47_E	51_V	1.147	1.00
29_M	32_K	1.147	1.00
67_L	83_W	1.144	1.00
70_K	83_W	1.076	1.00
68_F	86_L	1.052	1.00
32_K	116_P	1.046	1.00
96_G	99_G	1.041	1.00
67_L	70_K	1.041	1.00
55_Q	59_G	1.039	1.00
96_G	102_G	1.018	1.00
72_E	79_H	1.016	1.00
31_N	100_Q	1.001	1.00
27_A	98_E	0.994	1.00
121_P	124_A	0.982	1.00
53_E	57_E	0.979	1.00
94_P	102_G	0.967	1.00
48_Q	51_V	0.962	1.00
9_G	87_V	0.952	1.00
25_A	31_N	0.949	1.00
29_M	116_P	0.933	1.00
115_F	119_N	0.930	1.00
60_I	94_P	0.928	1.00
63_Q	89_R	0.927	1.00
7_A	50_V	0.924	1.00
66_S	86_L	0.898	1.00
67_L	85_W	0.895	1.00
62_P	87_V	0.894	1.00
50_V	85_W	0.885	1.00
12_R	16_N	0.871	1.00
84_F	122_V	0.869	1.00
116_P	119_N	0.868	1.00
62_P	65_F	0.868	1.00
35_F	84_F	0.859	1.00
25_A	30_A	0.849	1.00
46_P	83_W	0.848	1.00
54_L	60_I	0.843	1.00
111_N	124_A	0.842	1.00
24_A	100_Q	0.829	1.00
22_R	31_N	0.828	1.00
87_V	90_W	0.823	1.00
25_A	100_Q	0.804	1.00
10_I	84_F	0.794	1.00
120_E	124_A	0.793	1.00
103_E	109_G	0.788	0.99
51_V	61_T	0.788	0.99
19_F	60_I	0.787	0.99
47_E	85_W	0.777	0.99
24_A	98_E	0.770	0.99
12_R	18_I	0.769	0.99
68_F	125_K	0.763	0.99
69_E	122_V	0.750	0.99
65_F	86_L	0.749	0.99
22_R	33_L	0.747	0.99
54_L	87_V	0.737	0.99
58_V	102_G	0.698	0.99
5_Q	46_P	0.695	0.99
17_E	109_G	0.690	0.99
115_F	123_I	0.677	0.98
75_F	78_R	0.677	0.98
61_T	90_W	0.670	0.98
50_V	87_V	0.669	0.98
64_H	89_R	0.667	0.98
27_A	30_A	0.660	0.98
33_L	92_G	0.660	0.98
64_H	88_E	0.659	0.98
96_G	100_Q	0.659	0.98
78_R	82_L	0.652	0.98
34_E	99_G	0.650	0.98
5_Q	40_I	0.650	0.98
33_L	105_M	0.648	0.98
58_V	94_P	0.643	0.98
51_V	65_F	0.641	0.98
69_E	84_F	0.638	0.98
23_R	34_E	0.637	0.98
73_Y	80_I	0.636	0.98
91_E	94_P	0.632	0.98
50_V	54_L	0.631	0.98
34_E	80_I	0.630	0.98
71_L	82_L	0.626	0.97
55_Q	97_K	0.622	0.97
8_V	35_F	0.615	0.97
35_F	116_P	0.613	0.97
51_V	62_P	0.611	0.97
119_N	122_V	0.610	0.97
53_E	56_E	0.602	0.97
66_S	88_E	0.602	0.97
34_E	119_N	0.601	0.97
35_F	82_L	0.601	0.97
12_R	88_E	0.599	0.97
21_T	50_V	0.597	0.97
64_H	85_W	0.596	0.97
13_N	16_N	0.584	0.96
64_H	87_V	0.584	0.96
75_F	118_A	0.581	0.96
47_E	65_F	0.580	0.96
18_I	110_L	0.578	0.96
21_T	96_G	0.572	0.96
111_N	120_E	0.569	0.96
30_A	100_Q	0.569	0.96
29_M	77_D	0.567	0.96
33_L	101_P	0.566	0.95
74_E	77_D	0.565	0.95
116_P	122_V	0.561	0.95
64_H	67_L	0.559	0.95
89_R	94_P	0.559	0.95
21_T	58_V	0.557	0.95
105_M	109_G	0.556	0.95
34_E	39_K	0.555	0.95
35_F	119_N	0.555	0.95
80_I	83_W	0.551	0.95
13_N	93_E	0.548	0.95
75_F	80_I	0.547	0.95
18_I	35_F	0.547	0.95
8_V	34_E	0.546	0.95
39_K	57_E	0.545	0.94
60_I	92_G	0.544	0.94
106_S	110_L	0.540	0.94
117_P	120_E	0.533	0.94
65_F	85_W	0.530	0.94
23_R	39_K	0.526	0.93
6_I	119_N	0.526	0.93
63_Q	91_E	0.523	0.93
34_E	82_L	0.519	0.93
19_F	58_V	0.515	0.93
44_E	49_A	0.513	0.93
114_D	117_P	0.513	0.93
37_G	84_F	0.503	0.92
11_I	87_V	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1mutA	1	1	100	0.252	Contact Map
3gwyA	2	0.9922	100	0.268	Contact Map
2rrkA	1	0.9922	99.9	0.283	Contact Map
4v14A	1	0.9612	99.9	0.294	Contact Map
3hhjA	1	0.9767	99.9	0.295	Contact Map
3eesA	2	0.9845	99.9	0.296	Contact Map
3r03A	2	1	99.9	0.302	Contact Map
3q93A	1	0.9767	99.9	0.306	Contact Map
3fspA	1	0.969	99.9	0.31	Contact Map
1x51A	1	1	99.9	0.319	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.