HIS2 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIS2 - Histidine biosynthesis bifunctional protein HisIE

UniProt:	P06989	Sequences: MLTEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQLLAERKSADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHLLVLLQDQGLDLTTVIENLRKRHQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10451
Length:	203 (193)
Sequences:	1570 (908)
Seq/√Len:	65.3

ECOLI - HIS2
BACSU - HIS2
HALSA - HIS3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_T	74_V	4.373	1.00
135_T	178_Y	3.505	1.00
22_I	34_L	3.340	1.00
10_L	19_M	3.234	1.00
124_E	128_A	2.594	1.00
60_R	66_E	2.569	1.00
10_L	79_P	2.397	1.00
144_K	163_V	2.391	1.00
13_E	16_D	2.354	1.00
171_N	197_N	2.336	1.00
52_T	63_T	2.225	1.00
11_D	14_K	2.207	1.00
51_V	88_V	2.174	1.00
54_F	59_Q	2.173	1.00
50_K	63_T	2.152	1.00
71_F	93_I	2.137	1.00
170_T	197_N	2.062	1.00
73_N	93_I	2.057	1.00
75_V	91_N	2.048	1.00
92_P	95_P	2.046	1.00
44_K	47_E	2.037	1.00
144_K	162_T	2.037	1.00
73_N	91_N	1.936	1.00
39_P	43_D	1.928	1.00
21_V	37_M	1.921	1.00
43_D	47_E	1.894	1.00
197_N	200_K	1.853	1.00
34_L	85_T	1.852	1.00
101_T	106_G	1.845	1.00
30_E	102_S	1.835	1.00
50_K	73_N	1.830	1.00
119_E	185_Q	1.825	1.00
35_G	96_T	1.823	1.00
155_V	158_A	1.819	1.00
21_V	88_V	1.789	1.00
123_A	185_Q	1.788	1.00
173_A	184_L	1.781	1.00
23_V	53_F	1.771	1.00
151_G	155_V	1.767	1.00
130_P	136_A	1.701	0.99
148_Q	155_V	1.695	0.99
157_T	173_A	1.674	0.99
37_M	88_V	1.633	0.99
173_A	180_L	1.613	0.99
77_I	88_V	1.608	0.99
76_S	89_L	1.582	0.99
99_K	106_G	1.572	0.99
126_K	185_Q	1.560	0.99
129_D	136_A	1.557	0.99
50_K	71_F	1.553	0.99
143_T	186_D	1.496	0.99
21_V	41_A	1.469	0.98
177_M	180_L	1.461	0.98
60_R	67_T	1.440	0.98
169_L	189_L	1.430	0.98
51_V	74_V	1.429	0.98
29_G	89_L	1.409	0.98
44_K	61_L	1.407	0.98
44_K	52_T	1.349	0.97
63_T	66_E	1.340	0.97
157_T	176_L	1.324	0.97
166_R	189_L	1.304	0.97
173_A	177_M	1.300	0.96
142_G	146_I	1.273	0.96
53_F	92_P	1.238	0.95
166_R	193_T	1.234	0.95
174_S	194_V	1.225	0.95
44_K	48_S	1.220	0.95
136_A	140_A	1.192	0.94
33_M	85_T	1.191	0.94
26_A	75_V	1.179	0.94
129_D	132_T	1.159	0.93
126_K	139_Y	1.153	0.93
27_V	91_N	1.153	0.93
164_H	187_Q	1.144	0.93
161_A	183_L	1.138	0.93
33_M	87_L	1.138	0.93
174_S	197_N	1.135	0.93
44_K	63_T	1.110	0.92
115_L	191_L	1.109	0.92
157_T	180_L	1.108	0.92
135_T	182_V	1.092	0.91
160_A	168_E	1.089	0.91
128_A	136_A	1.078	0.91
20_P	34_L	1.072	0.90
70_N	92_P	1.070	0.90
74_V	105_F	1.065	0.90
196_E	199_R	1.065	0.90
143_T	187_Q	1.062	0.90
119_E	191_L	1.057	0.90
190_D	193_T	1.048	0.89
53_F	72_L	1.047	0.89
38_N	41_A	1.041	0.89
122_L	139_Y	1.036	0.89
166_R	187_Q	1.030	0.88
72_L	96_T	1.029	0.88
154_G	158_A	1.025	0.88
137_K	145_R	1.022	0.88
117_Q	202_H	1.016	0.88
145_R	159_L	1.014	0.88
178_Y	182_V	1.013	0.88
114_F	202_H	1.012	0.88
78_A	89_L	0.984	0.86
141_S	145_R	0.980	0.86
23_V	90_A	0.974	0.85
42_L	46_L	0.948	0.84
150_V	154_G	0.947	0.84
53_F	88_V	0.944	0.84
154_G	159_L	0.943	0.84
151_G	158_A	0.940	0.83
160_A	169_L	0.931	0.83
194_V	197_N	0.931	0.83
23_V	88_V	0.925	0.82
12_W	42_L	0.921	0.82
23_V	51_V	0.918	0.82
70_N	95_P	0.915	0.82
49_G	73_N	0.909	0.81
72_L	90_A	0.904	0.81
51_V	72_L	0.903	0.81
51_V	90_A	0.901	0.81
132_T	139_Y	0.898	0.80
10_L	42_L	0.893	0.80
48_S	52_T	0.892	0.80
181_L	191_L	0.889	0.80
50_K	66_E	0.874	0.79
31_V	87_L	0.872	0.78
54_F	66_E	0.872	0.78
72_L	92_P	0.857	0.77
115_L	181_L	0.853	0.77
126_K	188_G	0.847	0.76
143_T	161_A	0.843	0.76
76_S	108_T	0.831	0.75
138_L	182_V	0.830	0.75
70_N	93_I	0.830	0.75
132_T	140_A	0.820	0.74
165_D	168_E	0.818	0.74
128_A	132_T	0.794	0.72
74_V	88_V	0.791	0.71
189_L	193_T	0.791	0.71
161_A	169_L	0.786	0.71
196_E	200_K	0.783	0.71
38_N	61_L	0.782	0.71
92_P	102_S	0.779	0.70
11_D	57_T	0.777	0.70
54_F	60_R	0.773	0.70
123_A	127_S	0.767	0.69
188_G	195_I	0.765	0.69
110_H	113_L	0.762	0.69
46_L	77_I	0.748	0.67
35_G	51_V	0.747	0.67
148_Q	151_G	0.740	0.66
38_N	54_F	0.734	0.66
63_T	71_F	0.730	0.65
170_T	189_L	0.729	0.65
19_M	86_L	0.725	0.65
129_D	140_A	0.723	0.64
116_Y	120_Q	0.722	0.64
51_V	63_T	0.721	0.64
163_V	168_E	0.720	0.64
122_L	185_Q	0.717	0.64
169_L	187_Q	0.717	0.64
159_L	163_V	0.711	0.63
12_W	19_M	0.710	0.63
119_E	190_D	0.710	0.63
151_G	159_L	0.709	0.63
147_A	155_V	0.709	0.63
157_T	194_V	0.708	0.63
166_R	170_T	0.700	0.62
71_F	75_V	0.698	0.62
26_A	91_N	0.695	0.61
25_H	102_S	0.691	0.61
193_T	196_E	0.689	0.61
139_Y	146_I	0.688	0.61
74_V	77_I	0.688	0.61
192_T	196_E	0.683	0.60
192_T	199_R	0.678	0.60
126_K	129_D	0.675	0.59
143_T	154_G	0.675	0.59
132_T	136_A	0.671	0.59
157_T	174_S	0.670	0.59
137_K	141_S	0.669	0.58
116_Y	119_E	0.667	0.58
137_K	140_A	0.666	0.58
170_T	193_T	0.663	0.58
176_L	191_L	0.661	0.58
58_K	67_T	0.661	0.58
146_I	186_D	0.659	0.57
162_T	168_E	0.658	0.57
95_P	102_S	0.656	0.57
51_V	96_T	0.655	0.57
63_T	72_L	0.652	0.57
144_K	168_E	0.651	0.56
36_Y	85_T	0.649	0.56
122_L	181_L	0.647	0.56
143_T	162_T	0.646	0.56
145_R	155_V	0.646	0.56
191_L	195_I	0.646	0.56
121_L	202_H	0.645	0.56
51_V	77_I	0.642	0.55
150_V	176_L	0.637	0.55
20_P	36_Y	0.634	0.54
192_T	195_I	0.632	0.54
124_E	129_D	0.627	0.54
119_E	123_A	0.624	0.53
13_E	17_G	0.623	0.53
43_D	167_F	0.618	0.53
35_G	72_L	0.615	0.52
48_S	63_T	0.607	0.51
25_H	28_S	0.606	0.51
35_G	58_K	0.605	0.51
145_R	168_E	0.605	0.51
137_K	148_Q	0.603	0.51
64_K	98_H	0.600	0.50
197_N	201_R	0.600	0.50
41_A	51_V	0.592	0.50
144_K	159_L	0.588	0.49
46_L	49_G	0.587	0.49
45_T	51_V	0.583	0.48
22_I	87_L	0.582	0.48
22_I	31_V	0.577	0.48
126_K	136_A	0.576	0.48
21_V	29_G	0.575	0.48
52_T	61_L	0.574	0.47
53_F	90_A	0.574	0.47
164_H	186_D	0.572	0.47
133_S	136_A	0.570	0.47
57_T	85_T	0.570	0.47
178_Y	183_L	0.570	0.47
83_N	107_D	0.569	0.47
185_Q	188_G	0.567	0.47
168_E	171_N	0.565	0.46
28_S	102_S	0.564	0.46
13_E	108_T	0.563	0.46
143_T	169_L	0.558	0.46
28_S	192_T	0.557	0.45
106_G	109_A	0.556	0.45
99_K	107_D	0.555	0.45
164_H	168_E	0.554	0.45
37_M	41_A	0.554	0.45
115_L	195_I	0.553	0.45
11_D	58_K	0.552	0.45
13_E	18_L	0.550	0.45
123_A	128_A	0.549	0.45
33_M	92_P	0.547	0.44
85_T	105_F	0.547	0.44
122_L	130_P	0.547	0.44
157_T	160_A	0.547	0.44
37_M	51_V	0.546	0.44
20_P	85_T	0.545	0.44
95_P	202_H	0.542	0.44
37_M	45_T	0.542	0.44
31_V	201_R	0.540	0.43
39_P	83_N	0.539	0.43
41_A	45_T	0.538	0.43
67_T	135_T	0.538	0.43
147_A	151_G	0.537	0.43
170_T	174_S	0.536	0.43
89_L	178_Y	0.535	0.43
91_N	200_K	0.535	0.43
57_T	96_T	0.535	0.43
137_K	168_E	0.530	0.42
16_D	59_Q	0.529	0.42
148_Q	157_T	0.529	0.42
114_F	195_I	0.526	0.42
35_G	63_T	0.526	0.42
112_W	116_Y	0.524	0.42
170_T	200_K	0.523	0.42
70_N	128_A	0.523	0.42
121_L	139_Y	0.523	0.42
139_Y	185_Q	0.522	0.41
145_R	151_G	0.522	0.41
30_E	105_F	0.520	0.41
144_K	148_Q	0.517	0.41
143_T	147_A	0.517	0.41
66_E	120_Q	0.516	0.41
33_M	62_W	0.516	0.41
147_A	162_T	0.514	0.41
16_D	108_T	0.512	0.40
158_A	163_V	0.511	0.40
101_T	107_D	0.511	0.40
103_S	109_A	0.510	0.40
171_N	200_K	0.508	0.40
25_H	91_N	0.506	0.40
64_K	68_S	0.506	0.40
10_L	86_L	0.506	0.40
47_E	127_S	0.506	0.40
137_K	178_Y	0.505	0.40
17_G	142_G	0.504	0.39
123_A	190_D	0.503	0.39
25_H	92_P	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zpsA	2	0.6158	100	0.421	Contact Map
2a7wA	4	0.4483	100	0.636	Contact Map
1yvwA	4	0.4433	100	0.646	Contact Map
1yxbA	4	0.4089	100	0.653	Contact Map
1y6xA	3	0.4286	100	0.653	Contact Map
2yxhA	2	0.4138	99	0.86	Contact Map
2gtaA	4	0.4236	98.7	0.878	Contact Map
1vmgA	4	0.4039	98	0.898	Contact Map
2q5zA	4	0.4039	97.6	0.908	Contact Map
2oieA	3	0.4581	97.6	0.908	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.