DUT - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUT - Deoxyuridine 5'-triphosphate nucleotidohydrolase

UniProt:	P06968	Sequences: MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10251
Length:	151 (139)
Sequences:	3854 (2317)
Seq/√Len:	196.5

ECOLI - DUT
BACSU - YOSS YNCF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_T	27_S	2.667	1.00
57_H	136_D	2.642	1.00
111_Q	114_E	2.454	1.00
30_L	129_F	2.415	1.00
43_A	107_S	2.403	1.00
39_A	111_Q	2.356	1.00
65_A	119_M	2.302	1.00
43_A	46_D	2.081	1.00
27_S	91_D	2.045	1.00
24_T	91_D	2.015	1.00
41_E	109_T	2.013	1.00
77_H	108_F	1.973	1.00
75_H	99_S	1.924	1.00
29_G	120_I	1.896	1.00
26_G	90_S	1.861	1.00
51_P	97_M	1.824	1.00
22_Y	126_Q	1.738	1.00
47_T	78_G	1.730	1.00
79_I	108_F	1.728	1.00
16_E	112_P	1.719	1.00
68_L	87_L	1.701	1.00
58_I	121_F	1.679	1.00
46_D	105_Q	1.654	1.00
56_I	65_A	1.647	1.00
39_A	112_P	1.644	1.00
114_E	150_R	1.630	1.00
34_A	110_I	1.618	1.00
41_E	107_S	1.612	1.00
44_P	107_S	1.608	1.00
18_P	33_R	1.606	1.00
58_I	65_A	1.600	1.00
49_L	75_H	1.600	1.00
22_Y	30_L	1.600	1.00
57_H	93_Q	1.498	1.00
66_M	122_V	1.455	1.00
32_L	65_A	1.427	1.00
65_A	121_F	1.422	1.00
22_Y	127_A	1.398	1.00
66_M	87_L	1.391	1.00
17_F	112_P	1.382	1.00
64_A	87_L	1.376	1.00
12_R	131_L	1.373	1.00
68_L	122_V	1.370	1.00
49_L	97_M	1.366	1.00
51_P	95_Q	1.364	1.00
21_T	33_R	1.346	1.00
98_I	117_A	1.330	1.00
69_P	84_L	1.327	1.00
80_V	103_R	1.273	1.00
42_L	48_T	1.251	1.00
63_L	125_V	1.198	1.00
80_V	101_W	1.193	1.00
53_G	95_Q	1.183	1.00
39_A	109_T	1.176	1.00
99_S	145_F	1.175	1.00
121_F	127_A	1.172	1.00
10_D	19_L	1.151	1.00
63_L	121_F	1.142	1.00
23_A	33_R	1.133	1.00
64_A	68_L	1.132	1.00
32_L	119_M	1.112	1.00
68_L	85_V	1.111	1.00
67_M	117_A	1.101	1.00
9_L	57_H	1.098	1.00
35_C	112_P	1.097	1.00
52_T	98_I	1.087	1.00
67_M	119_M	1.084	1.00
58_I	63_L	1.078	1.00
70_R	115_R	1.065	1.00
98_I	116_I	1.062	1.00
13_V	55_A	1.059	1.00
14_G	35_C	1.055	1.00
69_P	80_V	1.052	1.00
26_G	60_D	1.049	1.00
17_F	35_C	1.027	1.00
82_G	101_W	1.008	1.00
14_G	17_F	1.007	1.00
64_A	122_V	1.003	1.00
34_A	38_D	0.990	1.00
45_G	105_Q	0.980	0.99
115_R	149_G	0.962	0.99
56_I	96_L	0.958	0.99
93_Q	135_F	0.945	0.99
40_V	50_V	0.942	0.99
32_L	67_M	0.935	0.99
28_A	90_S	0.935	0.99
44_P	102_N	0.927	0.99
77_H	114_E	0.924	0.99
47_T	101_W	0.910	0.99
45_G	103_R	0.910	0.99
30_L	119_M	0.907	0.99
14_G	53_G	0.905	0.99
23_A	147_H	0.903	0.99
28_A	64_A	0.894	0.99
56_I	119_M	0.892	0.99
50_V	100_V	0.887	0.99
40_V	110_I	0.886	0.99
55_A	135_F	0.878	0.99
81_L	100_V	0.872	0.99
14_G	18_P	0.865	0.99
82_G	99_S	0.858	0.99
143_G	148_S	0.857	0.99
38_D	51_P	0.831	0.98
40_V	48_T	0.828	0.98
80_V	84_L	0.822	0.98
25_S	139_D	0.819	0.98
66_M	120_I	0.818	0.98
35_C	51_P	0.814	0.98
54_L	96_L	0.811	0.98
69_P	81_L	0.805	0.98
69_P	85_V	0.804	0.98
68_L	120_I	0.803	0.98
12_R	19_L	0.798	0.98
75_H	97_M	0.797	0.98
77_H	150_R	0.795	0.98
67_M	98_I	0.794	0.98
10_D	13_V	0.786	0.98
42_L	102_N	0.778	0.97
11_P	14_G	0.778	0.97
82_G	85_V	0.773	0.97
81_L	85_V	0.766	0.97
23_A	148_S	0.763	0.97
34_A	50_V	0.760	0.97
66_M	85_V	0.760	0.97
30_L	127_A	0.749	0.97
49_L	99_S	0.744	0.97
45_G	104_G	0.741	0.97
57_H	135_F	0.740	0.96
28_A	58_I	0.736	0.96
78_G	104_G	0.732	0.96
90_S	124_V	0.730	0.96
11_P	55_A	0.721	0.96
100_V	116_I	0.711	0.96
85_V	99_S	0.709	0.96
74_G	99_S	0.708	0.95
110_I	116_I	0.704	0.95
32_L	54_L	0.703	0.95
12_R	17_F	0.700	0.95
9_L	12_R	0.697	0.95
58_I	90_S	0.695	0.95
88_I	99_S	0.694	0.95
33_R	54_L	0.690	0.95
143_G	147_H	0.683	0.95
67_M	81_L	0.680	0.94
77_H	106_D	0.678	0.94
69_P	83_N	0.675	0.94
38_D	48_T	0.672	0.94
16_E	35_C	0.660	0.93
24_T	148_S	0.658	0.93
32_L	117_A	0.656	0.93
47_T	103_R	0.656	0.93
32_L	98_I	0.652	0.93
79_I	100_V	0.650	0.93
64_A	120_I	0.649	0.93
11_P	134_D	0.643	0.93
88_I	96_L	0.642	0.93
87_L	120_I	0.630	0.92
10_D	131_L	0.630	0.92
75_H	82_G	0.622	0.91
38_D	112_P	0.614	0.91
93_Q	138_T	0.607	0.90
19_L	131_L	0.607	0.90
10_D	14_G	0.606	0.90
60_D	90_S	0.602	0.90
74_G	85_V	0.600	0.90
12_R	15_K	0.594	0.89
55_A	142_E	0.593	0.89
22_Y	129_F	0.593	0.89
11_P	15_K	0.591	0.89
28_A	124_V	0.591	0.89
71_S	144_G	0.589	0.89
34_A	39_A	0.588	0.89
13_V	17_F	0.588	0.89
134_D	137_A	0.585	0.89
55_A	95_Q	0.585	0.89
62_S	123_P	0.585	0.89
14_G	112_P	0.584	0.89
59_A	62_S	0.581	0.88
42_L	101_W	0.573	0.88
78_G	103_R	0.572	0.88
28_A	121_F	0.571	0.87
137_A	141_G	0.567	0.87
74_G	82_G	0.567	0.87
65_A	88_I	0.567	0.87
73_L	77_H	0.567	0.87
69_P	73_L	0.557	0.86
25_S	60_D	0.553	0.86
57_H	138_T	0.553	0.86
53_G	97_M	0.552	0.86
9_L	132_V	0.549	0.85
17_F	33_R	0.545	0.85
132_V	135_F	0.540	0.84
81_L	84_L	0.538	0.84
87_L	122_V	0.531	0.83
47_T	99_S	0.528	0.83
44_P	105_Q	0.528	0.83
127_A	131_L	0.526	0.83
9_L	130_N	0.525	0.83
18_P	112_P	0.524	0.83
58_I	62_S	0.521	0.82
124_V	129_F	0.521	0.82
15_K	112_P	0.514	0.81
64_A	85_V	0.511	0.81
82_G	103_R	0.507	0.81
96_L	119_M	0.503	0.80
23_A	26_G	0.503	0.80
86_G	89_D	0.501	0.80
17_F	113_G	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hzaA	3	0.9801	100	0.126	Contact Map
3mdxA	3	0.894	100	0.135	Contact Map
4gv8A	3	0.8411	100	0.142	Contact Map
3zf6A	3	0.9338	100	0.143	Contact Map
3tqzA	3	0.8808	100	0.146	Contact Map
3ecyA	2	0.7881	100	0.151	Contact Map
3f4fA	3	0.9073	100	0.152	Contact Map
1euwA	3	0.8609	100	0.153	Contact Map
3ca9A	3	0.8477	100	0.155	Contact Map
3t64A	3	0.9205	100	0.157	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.