ATKC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ATKC - Potassium-transporting ATPase C chain

UniProt:	P03961	Sequences: MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVELNLALDKLDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG10515
Length:	190 (182)
Sequences:	1765 (1245)
Seq/√Len:	92.3

ECOLI - ATKC
HALSA - ATKC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_Q	39_N	4.093	1.00
97_L	101_R	3.645	1.00
65_F	181_L	3.371	1.00
120_L	136_A	3.259	1.00
141_I	159_I	3.171	1.00
138_A	156_T	3.094	1.00
5_R	9_S	3.061	1.00
64_Y	186_D	2.931	1.00
42_L	49_V	2.819	1.00
72_T	76_P	2.661	1.00
53_A	180_E	2.623	1.00
142_P	152_V	2.566	1.00
131_N	164_Q	2.532	1.00
56_G	67_G	2.299	1.00
141_I	152_V	2.206	1.00
148_R	186_D	2.126	1.00
96_K	100_A	2.118	1.00
138_A	160_A	2.082	1.00
11_F	15_L	2.005	1.00
82_S	128_L	1.995	1.00
65_F	144_V	1.955	1.00
66_H	108_A	1.908	1.00
51_G	179_V	1.907	1.00
134_P	163_S	1.888	1.00
102_V	121_V	1.872	1.00
150_L	155_L	1.853	1.00
138_A	163_S	1.805	1.00
72_T	78_N	1.787	1.00
158_L	181_L	1.765	1.00
141_I	155_L	1.735	1.00
152_V	156_T	1.696	1.00
29_L	33_W	1.669	1.00
132_I	137_A	1.663	1.00
93_E	96_K	1.644	1.00
120_L	139_W	1.608	1.00
166_P	173_Q	1.593	1.00
151_S	154_Q	1.592	1.00
36_W	53_A	1.589	1.00
157_Q	161_K	1.587	1.00
131_N	175_V	1.577	1.00
154_Q	157_Q	1.543	1.00
44_R	49_V	1.534	1.00
65_F	158_L	1.447	1.00
162_Y	184_A	1.446	0.99
44_R	47_D	1.422	0.99
62_N	108_A	1.408	0.99
34_F	37_Q	1.406	0.99
164_Q	180_E	1.405	0.99
119_E	132_I	1.377	0.99
109_N	112_A	1.377	0.99
162_Y	180_E	1.329	0.99
66_H	109_N	1.302	0.99
109_N	139_W	1.300	0.99
119_E	133_T	1.300	0.99
141_I	156_T	1.294	0.99
96_K	99_A	1.272	0.99
166_P	174_P	1.261	0.99
144_V	181_L	1.260	0.99
148_R	185_L	1.254	0.99
92_P	96_K	1.254	0.99
61_G	64_Y	1.246	0.98
99_A	103_A	1.245	0.98
167_L	175_V	1.241	0.98
156_T	160_A	1.224	0.98
164_Q	175_V	1.218	0.98
138_A	142_P	1.212	0.98
144_V	147_A	1.194	0.98
167_L	171_I	1.180	0.98
95_D	99_A	1.173	0.98
72_T	83_G	1.159	0.98
97_L	123_A	1.125	0.97
65_F	159_I	1.102	0.97
105_L	139_W	1.097	0.97
85_S	123_A	1.085	0.96
102_V	106_R	1.082	0.96
71_A	123_A	1.071	0.96
16_L	21_V	1.063	0.96
101_R	123_A	1.059	0.96
21_V	25_L	1.054	0.96
56_G	76_P	1.040	0.95
105_L	136_A	1.024	0.95
132_I	178_I	1.024	0.95
153_E	156_T	1.019	0.95
14_L	18_T	1.018	0.95
59_F	179_V	1.015	0.95
10_T	14_L	1.012	0.95
106_R	111_D	1.010	0.95
87_L	94_L	1.005	0.94
138_A	141_I	0.999	0.94
137_A	144_V	0.978	0.94
112_A	139_W	0.962	0.93
150_L	188_L	0.962	0.93
105_L	110_P	0.951	0.93
19_G	27_T	0.942	0.92
82_S	126_S	0.930	0.92
135_Q	138_A	0.929	0.92
117_P	139_W	0.921	0.91
93_E	97_L	0.911	0.91
103_A	107_A	0.908	0.91
148_R	155_L	0.902	0.91
11_F	18_T	0.902	0.91
150_L	154_Q	0.894	0.90
110_P	139_W	0.892	0.90
58_N	67_G	0.892	0.90
156_T	159_I	0.889	0.90
28_V	32_W	0.886	0.90
59_F	148_R	0.884	0.90
134_P	159_I	0.883	0.90
64_Y	148_R	0.879	0.89
66_H	143_R	0.877	0.89
104_A	108_A	0.877	0.89
9_S	12_I	0.874	0.89
23_P	82_S	0.873	0.89
105_L	108_A	0.864	0.89
45_E	48_T	0.862	0.88
16_L	20_G	0.861	0.88
6_P	10_T	0.855	0.88
154_Q	161_K	0.852	0.88
30_G	35_P	0.848	0.88
106_R	109_N	0.847	0.88
15_L	18_T	0.844	0.87
142_P	146_K	0.843	0.87
109_N	143_R	0.838	0.87
15_L	19_G	0.826	0.86
43_I	183_L	0.825	0.86
69_P	123_A	0.822	0.86
111_D	139_W	0.820	0.86
169_K	175_V	0.816	0.86
101_R	104_A	0.815	0.86
161_K	184_A	0.813	0.85
41_S	52_S	0.795	0.84
136_A	139_W	0.794	0.84
24_L	28_V	0.794	0.84
6_P	9_S	0.786	0.83
89_V	95_D	0.785	0.83
116_V	121_V	0.784	0.83
27_T	30_G	0.782	0.83
44_R	48_T	0.777	0.83
105_L	111_D	0.764	0.82
146_K	149_N	0.764	0.82
158_L	188_L	0.761	0.81
45_E	183_L	0.760	0.81
55_I	82_S	0.759	0.81
160_A	163_S	0.756	0.81
168_V	171_I	0.753	0.81
27_T	34_F	0.750	0.80
58_N	76_P	0.749	0.80
115_S	139_W	0.749	0.80
179_V	183_L	0.749	0.80
94_L	97_L	0.744	0.80
88_A	97_L	0.731	0.79
105_L	109_N	0.730	0.79
59_F	64_Y	0.727	0.78
153_E	157_Q	0.722	0.78
26_T	89_V	0.719	0.78
144_V	185_L	0.716	0.77
79_P	82_S	0.715	0.77
67_G	136_A	0.692	0.75
20_G	26_T	0.691	0.75
106_R	139_W	0.689	0.75
11_F	14_L	0.689	0.75
61_G	66_H	0.684	0.74
101_R	105_L	0.681	0.74
20_G	23_P	0.681	0.74
142_P	155_L	0.677	0.73
10_T	183_L	0.675	0.73
67_G	120_L	0.672	0.73
160_A	165_Q	0.671	0.73
137_A	178_I	0.669	0.72
5_R	10_T	0.669	0.72
87_L	123_A	0.666	0.72
78_N	81_A	0.665	0.72
55_I	91_N	0.664	0.72
9_S	13_F	0.661	0.71
45_E	50_R	0.660	0.71
148_R	184_A	0.660	0.71
166_P	172_G	0.656	0.71
27_T	31_Q	0.653	0.71
105_L	116_V	0.651	0.70
100_A	103_A	0.651	0.70
169_K	172_G	0.644	0.70
134_P	138_A	0.641	0.69
72_T	127_G	0.641	0.69
134_P	166_P	0.640	0.69
168_V	175_V	0.631	0.68
40_G	52_S	0.631	0.68
81_A	84_G	0.631	0.68
79_P	88_A	0.627	0.67
111_D	146_K	0.626	0.67
22_Y	120_L	0.625	0.67
72_T	80_Q	0.625	0.67
159_I	163_S	0.624	0.67
100_A	104_A	0.623	0.67
43_I	179_V	0.621	0.67
77_Y	80_Q	0.617	0.66
109_N	117_P	0.616	0.66
67_G	147_A	0.612	0.66
23_P	126_S	0.611	0.65
109_N	114_A	0.610	0.65
105_L	112_A	0.610	0.65
48_T	99_A	0.608	0.65
105_L	120_L	0.605	0.65
91_N	95_D	0.603	0.64
72_T	81_A	0.601	0.64
87_L	93_E	0.600	0.64
58_N	66_H	0.600	0.64
145_A	148_R	0.600	0.64
55_I	128_L	0.599	0.64
62_N	147_A	0.599	0.64
19_G	23_P	0.596	0.64
84_G	127_G	0.593	0.63
12_I	29_L	0.593	0.63
76_P	79_P	0.588	0.63
134_P	175_V	0.585	0.62
163_S	172_G	0.582	0.62
67_G	179_V	0.578	0.61
17_I	23_P	0.575	0.61
23_P	40_G	0.575	0.61
29_L	32_W	0.574	0.61
70_S	91_N	0.573	0.61
56_G	179_V	0.572	0.60
56_G	77_Y	0.570	0.60
180_E	183_L	0.568	0.60
84_G	123_A	0.568	0.60
98_I	121_V	0.568	0.60
118_V	135_Q	0.566	0.60
120_L	132_I	0.566	0.60
38_A	41_S	0.565	0.59
18_T	84_G	0.561	0.59
109_N	142_P	0.560	0.59
30_G	58_N	0.558	0.59
14_L	17_I	0.557	0.58
109_N	113_S	0.553	0.58
102_V	113_S	0.553	0.58
24_L	95_D	0.553	0.58
63_G	146_K	0.552	0.58
18_T	23_P	0.548	0.57
116_V	119_E	0.547	0.57
70_S	82_S	0.547	0.57
56_G	72_T	0.540	0.56
145_A	155_L	0.539	0.56
18_T	21_V	0.537	0.56
76_P	81_A	0.534	0.55
114_A	153_E	0.532	0.55
24_L	27_T	0.532	0.55
183_L	187_K	0.532	0.55
64_Y	185_L	0.530	0.55
10_T	17_I	0.527	0.54
14_L	23_P	0.525	0.54
106_R	110_P	0.523	0.54
25_L	28_V	0.521	0.53
52_S	55_I	0.521	0.53
59_F	67_G	0.519	0.53
4_L	8_L	0.519	0.53
71_A	92_P	0.517	0.53
71_A	127_G	0.515	0.53
87_L	97_L	0.513	0.52
30_G	37_Q	0.513	0.52
158_L	184_A	0.511	0.52
107_A	188_L	0.511	0.52
41_S	54_L	0.510	0.52
29_L	90_S	0.510	0.52
152_V	155_L	0.509	0.52
84_G	128_L	0.508	0.52
65_F	70_S	0.508	0.52
159_I	181_L	0.507	0.52
66_H	139_W	0.507	0.52
123_A	127_G	0.507	0.52
9_S	181_L	0.506	0.51
12_I	151_S	0.506	0.51
59_F	147_A	0.505	0.51
71_A	84_G	0.504	0.51
59_F	89_V	0.500	0.51

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xrvA	1	0.7105	70	0.946	Contact Map
4utoA	1	0.7474	61.5	0.949	Contact Map
4lhfA	1	0.2895	43.3	0.954	Contact Map
4mt1A	3	0.9421	29.6	0.958	Contact Map
1toaA	1	0.7368	29.5	0.958	Contact Map
1xrsA	2	0.3211	27.6	0.959	Contact Map
4dx5A	3	0.9526	18.3	0.962	Contact Map
4h63V	1	0.5316	15.3	0.964	Contact Map
3oioA	1	0.3632	15	0.964	Contact Map
3pzpA	1	0.2789	14	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.