MIOC - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MIOC - Protein MioC

UniProt:	P03817	Sequences: MADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11199
Length:	147 (137)
Sequences:	3882 (2514)
Seq/√Len:	214.8

ECOLI - MIOC YQCA CYSJ FLAV FLAW
BACSU - CYSJ FLAV FLAW CYPD CYPE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
106_E	116_Q	3.980	1.00
89_G	102_I	3.896	1.00
103_D	122_K	3.349	1.00
11_T	64_D	2.998	1.00
84_R	115_K	2.731	1.00
110_K	116_Q	2.699	1.00
100_G	104_K	2.495	1.00
108_E	111_N	2.426	1.00
88_I	123_I	2.277	1.00
108_E	112_S	2.268	1.00
85_F	106_E	2.244	1.00
26_L	143_V	2.112	1.00
85_F	110_K	2.028	1.00
62_I	101_A	1.987	1.00
39_P	47_S	1.958	1.00
4_I	26_L	1.929	1.00
87_A	102_I	1.861	1.00
9_G	66_L	1.809	1.00
52_V	105_L	1.808	1.00
23_A	35_T	1.746	1.00
49_I	84_R	1.721	1.00
118_G	141_S	1.669	1.00
6_L	23_A	1.643	1.00
16_E	20_E	1.636	1.00
51_L	142_W	1.554	1.00
85_F	114_A	1.524	1.00
15_A	53_I	1.523	1.00
85_F	116_Q	1.507	1.00
106_E	110_K	1.481	1.00
9_G	54_S	1.480	1.00
10_S	65_N	1.460	1.00
52_V	109_L	1.456	1.00
54_S	105_L	1.423	1.00
18_V	135_A	1.406	1.00
58_G	61_D	1.377	1.00
106_E	120_T	1.373	1.00
103_D	120_T	1.366	1.00
70_Y	105_L	1.351	1.00
23_A	27_E	1.308	1.00
99_C	122_K	1.306	1.00
88_I	135_A	1.305	1.00
15_A	90_I	1.281	1.00
50_W	83_V	1.259	1.00
86_G	118_G	1.255	1.00
70_Y	104_K	1.254	1.00
69_F	105_L	1.247	1.00
55_S	63_P	1.225	1.00
18_V	90_I	1.224	1.00
109_L	114_A	1.217	1.00
7_I	39_P	1.207	1.00
7_I	50_W	1.201	1.00
74_Q	108_E	1.194	1.00
88_I	121_L	1.190	1.00
107_A	111_N	1.185	1.00
89_G	99_C	1.175	1.00
22_L	53_I	1.163	1.00
23_A	33_T	1.156	1.00
51_L	86_G	1.153	1.00
123_I	135_A	1.150	1.00
7_I	36_L	1.142	1.00
116_Q	119_E	1.128	1.00
22_L	139_L	1.116	1.00
86_G	142_W	1.092	1.00
25_K	139_L	1.084	1.00
56_T	99_C	1.084	1.00
54_S	101_A	1.080	1.00
36_L	39_P	1.079	1.00
62_I	66_L	1.076	1.00
62_I	70_Y	1.059	1.00
54_S	63_P	1.048	1.00
118_G	142_W	1.021	1.00
40_L	43_D	1.009	1.00
9_G	65_N	0.997	1.00
26_L	33_T	0.988	1.00
70_Y	108_E	0.979	1.00
70_Y	101_A	0.944	1.00
20_E	35_T	0.936	0.99
140_G	144_N	0.933	0.99
137_E	140_G	0.916	0.99
100_G	103_D	0.914	0.99
8_S	16_E	0.887	0.99
99_C	102_I	0.883	0.99
54_S	66_L	0.881	0.99
37_H	65_N	0.872	0.99
107_A	110_K	0.872	0.99
14_G	131_P	0.867	0.99
72_A	76_Q	0.853	0.99
93_R	126_L	0.852	0.99
82_A	115_K	0.851	0.99
80_L	114_A	0.842	0.99
137_E	141_S	0.838	0.99
10_S	15_A	0.838	0.99
119_E	141_S	0.835	0.99
5_T	47_S	0.834	0.99
25_K	140_G	0.831	0.99
36_L	69_F	0.824	0.99
39_P	72_A	0.823	0.99
17_Y	21_H	0.821	0.99
56_T	102_I	0.817	0.99
12_L	59_A	0.810	0.99
22_L	51_L	0.808	0.98
47_S	50_W	0.799	0.98
78_P	112_S	0.794	0.98
87_A	106_E	0.792	0.98
70_Y	74_Q	0.781	0.98
21_H	136_E	0.778	0.98
25_K	29_A	0.776	0.98
116_Q	120_T	0.776	0.98
24_E	27_E	0.769	0.98
74_Q	104_K	0.765	0.98
4_I	49_I	0.765	0.98
59_A	97_T	0.761	0.98
16_E	65_N	0.758	0.98
78_P	81_S	0.757	0.98
64_D	67_S	0.757	0.98
5_T	48_G	0.756	0.98
6_L	19_A	0.754	0.98
57_H	125_I	0.749	0.98
7_I	52_V	0.749	0.98
126_L	131_P	0.748	0.97
134_P	137_E	0.748	0.97
83_V	109_L	0.735	0.97
123_I	131_P	0.734	0.97
118_G	121_L	0.730	0.97
102_I	120_T	0.728	0.97
90_I	125_I	0.721	0.97
135_A	139_L	0.719	0.97
41_L	72_A	0.702	0.96
86_G	117_T	0.698	0.96
102_I	122_K	0.693	0.96
121_L	134_P	0.689	0.96
18_V	53_I	0.685	0.96
6_L	51_L	0.678	0.96
30_G	33_T	0.677	0.96
54_S	102_I	0.656	0.95
60_G	63_P	0.654	0.95
141_S	144_N	0.651	0.94
98_F	120_T	0.643	0.94
9_G	101_A	0.641	0.94
59_A	96_D	0.640	0.94
25_K	143_V	0.640	0.94
74_Q	107_A	0.640	0.94
11_T	15_A	0.635	0.94
5_T	34_E	0.632	0.94
36_L	66_L	0.631	0.94
73_L	112_S	0.629	0.93
46_A	82_A	0.627	0.93
4_I	51_L	0.614	0.93
71_E	75_E	0.613	0.93
10_S	17_Y	0.613	0.93
77_K	112_S	0.603	0.92
80_L	83_V	0.600	0.92
25_K	136_E	0.599	0.92
133_D	136_E	0.592	0.91
18_V	63_P	0.586	0.91
6_L	26_L	0.585	0.91
17_Y	20_E	0.585	0.91
53_I	88_I	0.584	0.91
131_P	135_A	0.583	0.91
15_A	132_E	0.583	0.91
8_S	53_I	0.582	0.90
5_T	39_P	0.581	0.90
37_H	68_P	0.575	0.90
133_D	137_E	0.571	0.90
95_Y	99_C	0.568	0.89
92_S	126_L	0.567	0.89
14_G	17_Y	0.567	0.89
26_L	31_F	0.567	0.89
52_V	63_P	0.564	0.89
31_F	49_I	0.563	0.89
77_K	81_S	0.557	0.88
24_E	28_E	0.557	0.88
15_A	55_S	0.557	0.88
62_I	104_K	0.556	0.88
62_I	105_L	0.555	0.88
73_L	109_L	0.553	0.88
12_L	125_I	0.547	0.88
24_E	29_A	0.546	0.87
4_I	31_F	0.545	0.87
91_G	95_Y	0.545	0.87
12_L	57_H	0.543	0.87
85_F	109_L	0.540	0.87
73_L	108_E	0.540	0.87
48_G	124_N	0.538	0.87
5_T	50_W	0.538	0.87
136_E	140_G	0.537	0.87
29_A	143_V	0.535	0.86
94_E	126_L	0.534	0.86
95_Y	102_I	0.533	0.86
66_L	69_F	0.533	0.86
59_A	67_S	0.532	0.86
30_G	35_T	0.529	0.86
14_G	55_S	0.526	0.86
58_G	90_I	0.525	0.85
84_R	117_T	0.523	0.85
11_T	57_H	0.523	0.85
57_H	100_G	0.519	0.85
51_L	117_T	0.513	0.84
90_I	102_I	0.512	0.84
9_G	63_P	0.510	0.84
42_E	77_K	0.509	0.84
103_D	107_A	0.508	0.84
31_F	143_V	0.508	0.84
79_D	112_S	0.507	0.83
61_D	132_E	0.507	0.83
61_D	95_Y	0.500	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1tllA	2	0.9728	100	0.181	Contact Map
2bpoA	1	0.9932	100	0.231	Contact Map
3qe2A	1	0.9864	100	0.233	Contact Map
3hr4A	2	0.9796	100	0.304	Contact Map
1bvyF	1	0.9796	100	0.378	Contact Map
2m6rA	1	1	100	0.398	Contact Map
4h2dA	1	0.9932	100	0.402	Contact Map
2hnaA	1	1	100	0.402	Contact Map
1ykgA	1	0.9524	100	0.409	Contact Map
4oxxA	1	0.9864	100	0.415	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.