T0927_1_91 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0927_1_91 - T0927 1-91

ID:	93	Sequences: EGFDQLGQLDTVDLNKLNEIEGSLNKAKDEMKASDLDRKVSDLESEARKQEAAIMDYNRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	91 (91)
Sequences:	218 (145)
Seq/√Len:	15.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_V	54_I	4.306	1.00
17_L	50_Q	2.868	0.97
17_L	24_L	2.729	0.96
79_P	82_C	2.657	0.96
24_L	39_K	2.086	0.86
82_C	89_E	2.001	0.83
36_L	50_Q	1.848	0.78
67_D	70_N	1.798	0.76
22_G	26_K	1.763	0.74
39_K	78_L	1.626	0.68
43_L	50_Q	1.623	0.68
50_Q	61_I	1.580	0.66
38_R	45_S	1.541	0.64
64_I	68_I	1.534	0.63
85_T	90_K	1.495	0.61
2_G	20_I	1.491	0.61
53_A	71_L	1.447	0.59
10_D	42_D	1.447	0.59
2_G	6_L	1.435	0.58
51_E	72_E	1.410	0.57
24_L	28_K	1.395	0.56
44_E	58_N	1.387	0.55
88_I	91_P	1.347	0.53
5_Q	10_D	1.300	0.51
40_V	61_I	1.294	0.50
2_G	71_L	1.276	0.49
2_G	88_I	1.239	0.47
67_D	79_P	1.224	0.46
85_T	91_P	1.214	0.46
72_E	84_N	1.197	0.45
44_E	67_D	1.197	0.45
44_E	72_E	1.197	0.45
80_T	86_P	1.193	0.45
64_I	71_L	1.162	0.43
50_Q	78_L	1.144	0.42
11_T	62_A	1.131	0.41
87_S	90_K	1.108	0.40
21_E	44_E	1.100	0.39
47_A	64_I	1.097	0.39
71_L	90_K	1.091	0.39
11_T	23_S	1.084	0.39
58_N	66_K	1.084	0.39
78_L	82_C	1.081	0.38
50_Q	64_I	1.071	0.38
25_N	62_A	1.038	0.36
74_I	79_P	1.019	0.35
35_D	57_Y	1.009	0.35
67_D	74_I	1.009	0.35
8_Q	40_V	0.994	0.34
63_E	66_K	0.986	0.33
66_K	80_T	0.982	0.33
75_K	91_P	0.982	0.33
61_I	67_D	0.979	0.33
68_I	91_P	0.961	0.32
5_Q	16_K	0.957	0.32
33_A	69_H	0.951	0.32
58_N	78_L	0.949	0.32
40_V	56_D	0.929	0.31
61_I	65_I	0.926	0.30
69_H	76_K	0.924	0.30
9_L	15_N	0.919	0.30
70_N	74_I	0.918	0.30
4_D	29_D	0.899	0.29
7_G	75_K	0.892	0.29
68_I	88_I	0.892	0.29
77_T	90_K	0.890	0.29
19_E	51_E	0.886	0.29
87_S	91_P	0.886	0.29
36_L	64_I	0.879	0.28
49_K	67_D	0.877	0.28
2_G	68_I	0.876	0.28
42_D	66_K	0.875	0.28
47_A	73_D	0.870	0.28
17_L	81_G	0.867	0.28
21_E	72_E	0.862	0.28
45_S	60_D	0.854	0.27
13_D	20_I	0.853	0.27
24_L	27_A	0.829	0.26
51_E	61_I	0.812	0.25
6_L	28_K	0.809	0.25
26_K	86_P	0.795	0.25
72_E	75_K	0.794	0.25
18_N	54_I	0.775	0.24
4_D	22_G	0.773	0.24
81_G	86_P	0.762	0.23
70_N	82_C	0.761	0.23
35_D	59_R	0.757	0.23
10_D	40_V	0.748	0.23
35_D	38_R	0.747	0.23
37_D	55_M	0.735	0.22
25_N	31_M	0.723	0.22
37_D	86_P	0.715	0.21
19_E	22_G	0.710	0.21
32_K	37_D	0.699	0.21
44_E	53_A	0.693	0.21
2_G	28_K	0.690	0.20
4_D	25_N	0.680	0.20
80_T	83_F	0.679	0.20
72_E	76_K	0.679	0.20
20_I	68_I	0.679	0.20
21_E	37_D	0.676	0.20
73_D	76_K	0.668	0.20
30_E	77_T	0.664	0.20
8_Q	28_K	0.661	0.19
3_F	81_G	0.657	0.19
12_V	53_A	0.656	0.19
56_D	76_K	0.646	0.19
47_A	63_E	0.641	0.19
48_R	60_D	0.621	0.18
74_I	82_C	0.605	0.18
9_L	43_L	0.603	0.17
16_K	35_D	0.603	0.17
3_F	27_A	0.602	0.17
36_L	43_L	0.601	0.17
37_D	51_E	0.597	0.17
27_A	42_D	0.594	0.17
46_E	49_K	0.593	0.17
17_L	78_L	0.592	0.17
57_Y	87_S	0.590	0.17
41_S	59_R	0.581	0.17
85_T	88_I	0.580	0.17
29_D	45_S	0.573	0.16
19_E	33_A	0.569	0.16
82_C	88_I	0.558	0.16
71_L	82_C	0.551	0.16
40_V	69_H	0.547	0.16
7_G	43_L	0.546	0.16
67_D	78_L	0.544	0.16
36_L	84_N	0.540	0.15
39_K	48_R	0.531	0.15
43_L	57_Y	0.525	0.15
44_E	62_A	0.521	0.15
83_F	89_E	0.517	0.15
4_D	26_K	0.517	0.15
14_L	36_L	0.502	0.14
29_D	35_D	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5bu8_A	1	0.1429	93.9	0.716	Contact Map
3c9i_A	1	0.9451	93.8	0.716	Contact Map
3ghg_B	1	0.978	68.8	0.798	Contact Map
3ghg_C	1	0.978	65.2	0.802	Contact Map
3ghg_A	1	1	64.2	0.804	Contact Map
1deq_A	1	0.9231	59.7	0.809	Contact Map
1m1j_B	1	1	54.3	0.815	Contact Map
4rsj_A	1	0.7802	53.1	0.816	Contact Map
4lin_A	1	0.967	52.7	0.817	Contact Map
4cgk_A	1	0.8681	52.3	0.818	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.