T0926_1_88 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0926_1_88 - T0926 1-88

ID:	92	Sequences: GEFESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	88 (74)
Sequences:	240 (174)
Seq/√Len:	20.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
49_Y	52_N	2.915	0.99
22_E	25_Q	2.458	0.97
24_L	42_L	2.384	0.97
76_D	80_K	2.287	0.96
24_L	31_L	2.144	0.94
39_L	74_L	2.126	0.93
77_I	87_C	2.065	0.92
23_L	26_N	1.962	0.90
77_I	84_Y	1.895	0.89
70_V	73_L	1.768	0.85
46_E	84_Y	1.695	0.82
80_K	83_V	1.666	0.81
42_L	74_L	1.559	0.76
28_A	31_L	1.553	0.76
28_A	35_A	1.495	0.73
42_L	49_Y	1.492	0.73
18_R	39_L	1.486	0.73
32_L	35_A	1.461	0.71
26_N	30_T	1.414	0.69
17_A	39_L	1.392	0.68
24_L	66_L	1.366	0.66
31_L	35_A	1.336	0.64
29_K	33_A	1.333	0.64
28_A	66_L	1.325	0.64
19_R	38_K	1.318	0.63
63_L	66_L	1.287	0.61
26_N	36_N	1.259	0.60
84_Y	87_C	1.245	0.59
16_D	57_E	1.241	0.58
27_E	59_K	1.228	0.58
43_E	79_E	1.205	0.56
38_K	49_Y	1.157	0.53
57_E	80_K	1.096	0.49
40_Q	54_K	1.096	0.49
75_K	80_K	1.075	0.48
67_E	84_Y	1.066	0.47
20_K	28_A	1.051	0.46
21_A	63_L	1.047	0.46
16_D	54_K	1.037	0.45
26_N	37_S	1.004	0.43
51_D	58_D	0.995	0.43
85_S	88_L	0.994	0.42
45_L	81_V	0.988	0.42
36_N	54_K	0.951	0.40
78_S	85_S	0.946	0.39
62_E	76_D	0.935	0.39
68_G	82_A	0.920	0.38
59_K	73_L	0.920	0.38
67_E	86_T	0.917	0.38
19_R	72_S	0.882	0.36
37_S	41_L	0.851	0.34
23_L	51_D	0.842	0.33
41_L	59_K	0.832	0.33
18_R	22_E	0.826	0.32
21_A	29_K	0.826	0.32
61_Q	69_E	0.824	0.32
67_E	85_S	0.816	0.32
68_G	72_S	0.814	0.32
59_K	67_E	0.810	0.31
28_A	63_L	0.793	0.30
16_D	19_R	0.793	0.30
25_Q	49_Y	0.781	0.30
31_L	66_L	0.780	0.30
25_Q	28_A	0.776	0.30
25_Q	85_S	0.765	0.29
18_R	50_E	0.764	0.29
38_K	74_L	0.760	0.29
53_Q	77_I	0.752	0.28
21_A	73_L	0.752	0.28
21_A	24_L	0.744	0.28
82_A	85_S	0.738	0.27
63_L	70_V	0.736	0.27
51_D	55_Y	0.714	0.26
54_K	72_S	0.714	0.26
45_L	67_E	0.711	0.26
31_L	45_L	0.707	0.26
38_K	60_A	0.703	0.26
21_A	32_L	0.701	0.26
69_E	78_S	0.689	0.25
36_N	43_E	0.680	0.25
52_N	56_L	0.677	0.24
60_A	69_E	0.671	0.24
23_L	30_T	0.664	0.24
21_A	56_L	0.646	0.23
42_L	65_R	0.643	0.23
23_L	75_K	0.635	0.22
57_E	64_V	0.626	0.22
32_L	81_V	0.624	0.22
33_A	43_E	0.619	0.22
58_D	61_Q	0.596	0.21
26_N	70_V	0.577	0.20
45_L	56_L	0.570	0.20
18_R	35_A	0.568	0.20
62_E	71_R	0.562	0.19
37_S	58_D	0.559	0.19
37_S	65_R	0.550	0.19
17_A	57_E	0.544	0.19
38_K	46_E	0.539	0.18
74_L	87_C	0.532	0.18
70_V	77_I	0.528	0.18
49_Y	55_Y	0.526	0.18
44_D	58_D	0.520	0.18
33_A	41_L	0.520	0.18
48_K	80_K	0.517	0.18
15_A	43_E	0.516	0.18
82_A	86_T	0.514	0.17
63_L	80_K	0.511	0.17
55_Y	69_E	0.509	0.17
41_L	67_E	0.508	0.17
45_L	49_Y	0.501	0.17
30_T	40_Q	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c9i_A	1	1	88.8	0.692	Contact Map
4lin_A	1	1	83.7	0.714	Contact Map
5bu8_A	1	0.1477	81.3	0.722	Contact Map
4cgk_A	1	0.8409	78.9	0.729	Contact Map
1i84_S	1	0.0682	74.8	0.738	Contact Map
4q4g_X	1	0	73.7	0.74	Contact Map
3ghg_A	1	0.9659	73.5	0.741	Contact Map
1deq_A	1	0.9886	72.8	0.742	Contact Map
2dfs_A	1	0.875	71.2	0.745	Contact Map
4rsi_B	1	1	64.9	0.756	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.