T0869_1_120 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0869_1_120 - T0869 1-120

ID:	9	Sequences: KMAGSIVISKEVRVPVSTSQFDYLVSRIGDQFHSSDMWIKDEVYLPMEEGGMSFISTESLNSSGLSIFLATVMRARAASQAEESFPLYENVWNQLVEKLRQDARLGVSGNTSLEHHHHHH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	120 (105)
Sequences:	28 (24)
Seq/√Len:	2.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_V	105_L	3.185	0.43
8_I	18_T	2.354	0.27
28_I	57_T	2.346	0.26
65_L	102_D	2.342	0.26
65_L	104_R	2.342	0.26
60_L	92_W	2.274	0.25
64_G	107_V	2.135	0.23
9_S	32_F	1.955	0.20
86_P	98_K	1.898	0.19
46_P	73_M	1.857	0.19
70_A	73_M	1.846	0.19
8_I	95_L	1.783	0.18
7_V	26_S	1.776	0.18
19_S	101_Q	1.726	0.17
17_S	86_P	1.708	0.17
62_S	106_G	1.702	0.17
28_I	51_G	1.590	0.16
23_Y	40_K	1.574	0.15
8_I	63_S	1.564	0.15
38_W	84_S	1.522	0.15
92_W	104_R	1.508	0.15
92_W	102_D	1.508	0.15
95_L	100_R	1.436	0.14
32_F	95_L	1.430	0.14
24_L	55_I	1.414	0.14
2_M	94_Q	1.392	0.13
27_R	37_M	1.362	0.13
65_L	69_L	1.350	0.13
24_L	33_H	1.341	0.13
6_I	36_D	1.328	0.13
2_M	8_I	1.326	0.13
5_S	78_A	1.311	0.13
31_Q	75_A	1.282	0.12
9_S	42_E	1.268	0.12
46_P	85_F	1.267	0.12
32_F	102_D	1.259	0.12
32_F	104_R	1.259	0.12
63_S	94_Q	1.258	0.12
11_E	63_S	1.229	0.12
86_P	106_G	1.228	0.12
66_S	105_L	1.226	0.12
32_F	66_S	1.209	0.12
39_I	73_M	1.199	0.12
4_G	85_F	1.184	0.11
40_K	82_E	1.160	0.11
14_V	63_S	1.151	0.11
40_K	66_S	1.147	0.11
5_S	15_P	1.145	0.11
43_V	65_L	1.142	0.11
30_D	81_A	1.141	0.11
73_M	97_E	1.122	0.11
43_V	66_S	1.098	0.11
47_M	87_L	1.091	0.11
4_G	70_A	1.086	0.11
94_Q	107_V	1.077	0.11
8_I	102_D	1.062	0.10
8_I	104_R	1.062	0.10
57_T	60_L	1.039	0.10
13_R	62_S	1.025	0.10
15_P	95_L	1.016	0.10
64_G	106_G	0.992	0.10
29_G	44_Y	0.987	0.10
5_S	19_S	0.984	0.10
2_M	92_W	0.983	0.10
10_K	62_S	0.961	0.10
2_M	9_S	0.958	0.10
8_I	94_Q	0.946	0.09
15_P	32_F	0.943	0.09
26_S	72_V	0.938	0.09
30_D	76_R	0.922	0.09
41_D	65_L	0.913	0.09
39_I	96_V	0.907	0.09
8_I	62_S	0.905	0.09
61_N	93_N	0.903	0.09
75_A	98_K	0.887	0.09
92_W	105_L	0.879	0.09
17_S	105_L	0.875	0.09
73_M	85_F	0.863	0.09
9_S	12_V	0.860	0.09
16_V	95_L	0.857	0.09
57_T	99_L	0.848	0.09
63_S	78_A	0.835	0.09
24_L	73_M	0.833	0.09
32_F	39_I	0.828	0.09
17_S	77_A	0.827	0.09
52_M	104_R	0.821	0.09
52_M	102_D	0.821	0.09
16_V	32_F	0.806	0.08
25_V	53_S	0.799	0.08
33_H	37_M	0.796	0.08
68_F	99_L	0.788	0.08
21_F	54_F	0.786	0.08
22_D	46_P	0.774	0.08
68_F	78_A	0.768	0.08
77_A	100_R	0.767	0.08
28_I	75_A	0.759	0.08
63_S	77_A	0.755	0.08
85_F	97_E	0.754	0.08
10_K	74_R	0.744	0.08
22_D	94_Q	0.744	0.08
6_I	54_F	0.742	0.08
55_I	64_G	0.740	0.08
17_S	46_P	0.722	0.08
33_H	40_K	0.710	0.08
23_Y	83_E	0.706	0.08
31_Q	76_R	0.703	0.08
47_M	81_A	0.702	0.08
17_S	69_L	0.701	0.08
37_M	72_V	0.698	0.08
97_E	102_D	0.693	0.08
97_E	104_R	0.693	0.08
39_I	60_L	0.692	0.08
38_W	82_E	0.688	0.08
36_D	84_S	0.682	0.08
19_S	80_Q	0.676	0.08
43_V	57_T	0.668	0.08
59_S	75_A	0.662	0.08
26_S	106_G	0.654	0.07
12_V	56_S	0.653	0.07
5_S	12_V	0.651	0.07
32_F	54_F	0.619	0.07
24_L	81_A	0.615	0.07
43_V	71_T	0.614	0.07
33_H	71_T	0.610	0.07
15_P	77_A	0.606	0.07
101_Q	106_G	0.604	0.07
75_A	99_L	0.602	0.07
63_S	68_F	0.597	0.07
26_S	78_A	0.593	0.07
8_I	97_E	0.586	0.07
51_G	88_Y	0.586	0.07
64_G	86_P	0.581	0.07
29_G	52_M	0.581	0.07
51_G	57_T	0.573	0.07
20_Q	55_I	0.569	0.07
3_A	85_F	0.564	0.07
3_A	84_S	0.556	0.07
62_S	95_L	0.555	0.07
8_I	108_S	0.555	0.07
4_G	51_G	0.555	0.07
9_S	14_V	0.553	0.07
19_S	78_A	0.546	0.07
68_F	80_Q	0.543	0.07
19_S	68_F	0.540	0.07
6_I	13_R	0.538	0.07
6_I	10_K	0.537	0.07
2_M	6_I	0.535	0.07
61_N	106_G	0.534	0.07
26_S	41_D	0.533	0.07
51_G	54_F	0.531	0.07
92_W	97_E	0.526	0.07
17_S	61_N	0.524	0.07
32_F	48_E	0.523	0.07
10_K	13_R	0.519	0.07
68_F	83_E	0.514	0.07
21_F	53_S	0.509	0.07
3_A	83_E	0.507	0.07
3_A	101_Q	0.500	0.07

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4fqg_A	1	0.4583	15.1	0.926	Contact Map
2b7e_A	1	0.4333	15	0.926	Contact Map
3hfh_A	1	0.0583	13.3	0.928	Contact Map
2p7n_A	1	0.825	11.4	0.93	Contact Map
2ck3_A	1	0.5833	11.2	0.93	Contact Map
3nft_A	1	0.8083	9.8	0.932	Contact Map
5cdf_A	1	0.575	8.4	0.934	Contact Map
1wch_A	1	0.65	8.3	0.934	Contact Map
4yzz_A	1	0.925	8	0.935	Contact Map
2juc_A	1	0.425	8	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.