T0922_21_93 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0922_21_93 - T0922 21-93

ID:	88	Sequences: MASVQKFPGDANCDGIVDISDAVLIMQTMANPSKYQMTDKGRINADVTGNSDGVTVLDAQFIQSYCLGLVELP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	73 (64)
Sequences:	1140 (1028)
Seq/√Len:	128.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_V	60_Q	3.397	1.00
19_I	56_V	3.013	1.00
26_M	63_Q	2.842	1.00
48_T	51_S	2.623	1.00
30_A	67_L	2.557	1.00
20_S	57_L	2.462	1.00
25_I	62_I	2.223	1.00
31_N	68_G	1.800	1.00
12_N	18_D	1.770	1.00
27_Q	64_S	1.713	1.00
35_Y	41_G	1.713	1.00
16_I	53_G	1.650	1.00
32_P	69_L	1.560	1.00
38_T	41_G	1.530	1.00
29_M	66_C	1.504	1.00
17_V	65_Y	1.454	1.00
18_D	55_T	1.450	1.00
6_K	44_N	1.414	1.00
64_S	69_L	1.395	1.00
22_A	66_C	1.374	1.00
29_M	59_A	1.227	1.00
8_P	49_G	1.183	0.99
40_K	44_N	1.180	0.99
11_A	25_I	1.151	0.99
19_I	23_V	1.136	0.99
59_A	63_Q	1.049	0.98
30_A	63_Q	1.019	0.98
47_V	65_Y	1.019	0.98
48_T	55_T	1.016	0.98
48_T	52_D	1.015	0.98
39_D	42_R	0.986	0.98
35_Y	38_T	0.977	0.98
13_C	41_G	0.943	0.97
11_A	24_L	0.919	0.96
35_Y	40_K	0.914	0.96
11_A	45_A	0.914	0.96
29_M	63_Q	0.892	0.96
26_M	59_A	0.890	0.96
12_N	20_S	0.889	0.96
63_Q	67_L	0.875	0.95
45_A	54_V	0.874	0.95
28_T	34_K	0.872	0.95
46_D	51_S	0.872	0.95
10_D	14_D	0.838	0.94
22_A	59_A	0.836	0.94
28_T	42_R	0.834	0.94
48_T	61_F	0.826	0.94
17_V	62_I	0.823	0.94
24_L	61_F	0.792	0.92
47_V	62_I	0.760	0.91
65_Y	70_V	0.759	0.90
8_P	43_I	0.756	0.90
19_I	60_Q	0.754	0.90
40_K	43_I	0.742	0.89
51_S	55_T	0.731	0.89
46_D	52_D	0.695	0.86
10_D	21_D	0.689	0.86
42_R	54_V	0.685	0.85
8_P	47_V	0.681	0.85
33_S	41_G	0.671	0.84
26_M	56_V	0.670	0.84
57_L	61_F	0.665	0.84
23_V	27_Q	0.661	0.83
11_A	44_N	0.644	0.82
28_T	35_Y	0.640	0.81
8_P	65_Y	0.636	0.81
7_F	15_G	0.634	0.81
14_D	18_D	0.628	0.80
20_S	66_C	0.621	0.79
15_G	21_D	0.613	0.78
13_C	44_N	0.602	0.77
17_V	44_N	0.600	0.77
5_Q	69_L	0.600	0.77
22_A	63_Q	0.593	0.76
22_A	26_M	0.592	0.76
20_S	27_Q	0.587	0.75
21_D	58_D	0.586	0.75
17_V	47_V	0.580	0.75
28_T	39_D	0.580	0.75
40_K	47_V	0.580	0.75
7_F	13_C	0.574	0.74
62_I	66_C	0.573	0.74
26_M	30_A	0.558	0.72
5_Q	13_C	0.556	0.71
49_G	52_D	0.548	0.70
35_Y	54_V	0.545	0.70
64_S	70_V	0.539	0.69
11_A	62_I	0.537	0.69
24_L	33_S	0.530	0.68
34_K	71_E	0.524	0.67
41_G	44_N	0.523	0.67
15_G	71_E	0.523	0.67
8_P	13_C	0.510	0.65
31_N	64_S	0.509	0.65
52_D	55_T	0.509	0.65
47_V	70_V	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yik_A	1	0	99.5	-0.033	Contact Map
4fl4_A	1	0.9041	99.4	-0.013	Contact Map
4cj0_A	1	0	99.4	-0.012	Contact Map
4uyp_B	1	0.9315	99.4	-0.006	Contact Map
4dh2_B	1	0.9178	99.4	0.027	Contact Map
2ccl_B	1	0.8493	99.3	0.066	Contact Map
1daq_A	1	0.9041	99.3	0.073	Contact Map
2y3n_B	1	0.8219	99.3	0.081	Contact Map
2vn6_B	1	0.863	99.2	0.089	Contact Map
3ul4_B	1	0.863	99.2	0.101	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.