T0921_1_149 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0921_1_149 - T0921 1-149

ID:	86	Sequences: MPVANADVVFDFQNYTAKAGDEVTVDVLVDSKNKPISAMDVKFKVDSPLTIEEIDKESLAFNTTVMTNMAILGANFKSLDDKGEPLVPKDGAAVFTLYVNVPANTPDGTYYVGFNGKNEVHKSNDGSQFTVASKNGAITVGTPNEEGLE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	149 (134)
Sequences:	1656 (1459)
Seq/√Len:	126.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_A	101_V	3.791	1.00
50_T	102_P	3.704	1.00
50_T	100_N	3.240	1.00
51_I	97_L	3.069	1.00
52_E	100_N	3.041	1.00
48_P	110_Y	2.959	1.00
24_T	98_Y	2.858	1.00
45_V	99_V	2.717	1.00
45_V	69_M	2.621	1.00
26_D	96_T	2.464	1.00
123_S	127_S	2.351	1.00
51_I	99_V	2.288	1.00
23_V	101_V	2.276	1.00
24_T	96_T	2.195	1.00
28_L	93_A	2.130	1.00
12_F	136_G	2.080	1.00
17_A	23_V	1.922	1.00
41_V	76_F	1.889	1.00
110_Y	140_V	1.879	1.00
22_E	98_Y	1.856	1.00
18_K	21_D	1.845	1.00
49_L	99_V	1.808	1.00
51_I	74_A	1.755	1.00
109_T	137_A	1.656	1.00
60_A	92_A	1.631	1.00
10_F	43_F	1.603	1.00
22_E	100_N	1.530	1.00
39_M	94_V	1.520	1.00
19_A	103_A	1.470	1.00
44_K	115_N	1.454	1.00
38_A	122_K	1.448	1.00
101_V	140_V	1.429	1.00
43_F	97_L	1.426	1.00
27_V	95_F	1.410	1.00
51_I	54_I	1.401	1.00
46_D	110_Y	1.397	1.00
17_A	138_I	1.366	1.00
36_I	129_F	1.358	1.00
27_V	97_L	1.308	1.00
25_V	112_V	1.292	1.00
16_T	139_T	1.262	1.00
31_S	90_D	1.260	1.00
9_V	30_D	1.253	1.00
69_M	72_L	1.234	1.00
53_E	98_Y	1.233	0.99
13_Q	26_D	1.215	0.99
20_G	101_V	1.200	0.99
57_E	61_F	1.178	0.99
49_L	112_V	1.147	0.99
52_E	98_Y	1.133	0.99
30_D	91_G	1.126	0.99
19_A	102_P	1.114	0.99
48_P	140_V	1.110	0.99
124_N	127_S	1.110	0.99
25_V	99_V	1.101	0.99
40_D	122_K	1.101	0.99
68_N	71_I	1.101	0.99
27_V	41_V	1.090	0.99
45_V	72_L	1.083	0.99
121_H	131_V	1.057	0.98
60_A	63_T	1.055	0.98
23_V	138_I	1.054	0.98
114_F	117_K	1.026	0.98
12_F	15_Y	1.020	0.98
42_K	116_G	0.989	0.98
49_L	110_Y	0.983	0.97
68_N	72_L	0.973	0.97
38_A	120_V	0.958	0.97
128_Q	131_V	0.947	0.97
109_T	139_T	0.939	0.97
55_D	84_E	0.934	0.97
123_S	129_F	0.932	0.97
87_V	90_D	0.917	0.96
37_S	79_L	0.915	0.96
76_F	95_F	0.914	0.96
117_K	133_S	0.909	0.96
46_D	58_S	0.904	0.96
19_A	140_V	0.903	0.96
44_K	73_G	0.902	0.96
7_D	132_A	0.899	0.96
10_F	27_V	0.898	0.96
32_K	36_I	0.897	0.96
15_Y	138_I	0.894	0.96
90_D	94_V	0.890	0.96
93_A	96_T	0.889	0.95
42_K	75_N	0.870	0.95
26_D	93_A	0.866	0.95
22_E	52_E	0.862	0.95
27_V	117_K	0.845	0.94
29_V	94_V	0.839	0.94
43_F	119_E	0.828	0.93
117_K	131_V	0.826	0.93
10_F	112_V	0.817	0.93
27_V	114_F	0.802	0.92
40_D	116_G	0.790	0.92
36_I	39_M	0.762	0.90
28_L	46_D	0.761	0.90
40_D	77_K	0.757	0.90
54_I	74_A	0.753	0.90
49_L	72_L	0.750	0.90
19_A	101_V	0.743	0.89
102_P	110_Y	0.738	0.89
13_Q	27_V	0.738	0.89
37_S	80_D	0.725	0.88
8_V	12_F	0.717	0.87
55_D	98_Y	0.716	0.87
133_S	138_I	0.708	0.87
122_K	126_G	0.704	0.86
48_P	103_A	0.700	0.86
77_K	83_G	0.698	0.86
74_A	94_V	0.698	0.86
69_M	74_A	0.693	0.85
120_V	128_Q	0.689	0.85
47_S	102_P	0.689	0.85
38_A	86_L	0.688	0.85
15_Y	25_V	0.683	0.85
111_Y	137_A	0.682	0.85
33_N	97_L	0.676	0.84
111_Y	135_N	0.676	0.84
48_P	108_G	0.672	0.84
113_G	135_N	0.664	0.83
39_M	56_K	0.662	0.83
33_N	36_I	0.657	0.82
44_K	113_G	0.656	0.82
28_L	92_A	0.656	0.82
107_D	141_G	0.652	0.82
51_I	69_M	0.650	0.82
114_F	133_S	0.647	0.81
58_S	92_A	0.647	0.81
26_D	91_G	0.646	0.81
56_K	112_V	0.642	0.81
12_F	138_I	0.639	0.81
51_I	67_T	0.636	0.80
59_L	97_L	0.633	0.80
57_E	92_A	0.630	0.80
74_A	99_V	0.630	0.80
8_V	42_K	0.629	0.80
43_F	74_A	0.627	0.79
16_T	117_K	0.625	0.79
103_A	140_V	0.622	0.79
22_E	27_V	0.620	0.79
42_K	73_G	0.618	0.78
54_I	95_F	0.614	0.78
18_K	129_F	0.612	0.78
64_T	67_T	0.612	0.78
9_V	28_L	0.610	0.77
44_K	139_T	0.607	0.77
47_S	115_N	0.607	0.77
114_F	138_I	0.606	0.77
5_N	32_K	0.601	0.76
109_T	132_A	0.584	0.74
15_Y	136_G	0.583	0.74
36_I	121_H	0.583	0.74
29_V	36_I	0.582	0.74
55_D	96_T	0.581	0.74
43_F	66_M	0.581	0.74
70_A	113_G	0.579	0.74
46_D	49_L	0.577	0.73
34_K	115_N	0.576	0.73
10_F	135_N	0.572	0.73
13_Q	28_L	0.570	0.73
65_V	78_S	0.569	0.72
25_V	58_S	0.568	0.72
39_M	42_K	0.568	0.72
31_S	91_G	0.565	0.72
32_K	91_G	0.564	0.72
39_M	127_S	0.560	0.71
10_F	32_K	0.560	0.71
26_D	136_G	0.559	0.71
50_T	93_A	0.559	0.71
108_G	140_V	0.557	0.71
14_N	70_A	0.556	0.71
58_S	61_F	0.555	0.71
55_D	64_T	0.554	0.70
32_K	89_K	0.548	0.70
78_S	94_V	0.548	0.70
87_V	124_N	0.546	0.69
113_G	142_T	0.546	0.69
65_V	122_K	0.545	0.69
67_T	71_I	0.534	0.68
28_L	49_L	0.532	0.67
39_M	78_S	0.528	0.67
10_F	29_V	0.527	0.67
20_G	23_V	0.527	0.67
22_E	109_T	0.526	0.66
83_G	86_L	0.526	0.66
77_K	120_V	0.526	0.66
27_V	74_A	0.526	0.66
29_V	39_M	0.522	0.66
37_S	59_L	0.521	0.66
37_S	124_N	0.518	0.65
43_F	142_T	0.516	0.65
67_T	70_A	0.514	0.65
110_Y	141_G	0.511	0.64
82_K	122_K	0.511	0.64
115_N	131_V	0.510	0.64
102_P	138_I	0.508	0.64
35_P	89_K	0.508	0.64
5_N	141_G	0.507	0.64
97_L	113_G	0.503	0.63
16_T	134_K	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vn6_A	1	0.9463	99.6	0.313	Contact Map
3ul4_A	1	0.906	99.6	0.318	Contact Map
4ums_A	1	0.953	99.6	0.338	Contact Map
2ccl_A	1	0.9329	99.6	0.345	Contact Map
1aoh_A	1	0.8993	99.5	0.347	Contact Map
4dh2_A	1	0.953	99.5	0.353	Contact Map
3kcp_A	1	0.953	99.4	0.386	Contact Map
2xdh_A	1	0.8926	99.4	0.392	Contact Map
4uyp_A	1	0.9195	99.1	0.475	Contact Map
2vo8_A	1	0.8658	98.8	0.533	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.