T0868_1_161 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0868_1_161 - T0868 1-161

ID:	8	Sequences: MGASSGSNISASNGSSSPTTIVASNPVDLNAFDRLNVVDPAVGKFRPGEAGAAAELENYLGGTLQRAPQGSSVDFVFSSGPNNGKTVDFMLTPDTVAQAAKINQFFDKNLNNFMNTLSDHAAAADFVPLASRFLSEANKTLLVKAIGNLPQKLQAKIILIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	161 (141)
Sequences:	36 (27)
Seq/√Len:	2.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_F	117_L	3.427	0.48
102_I	106_F	3.032	0.40
56_L	146_I	2.970	0.38
138_N	156_K	2.783	0.35
139_K	161_K	2.770	0.34
151_Q	155_A	2.433	0.28
29_L	146_I	2.328	0.26
105_F	109_N	2.260	0.25
102_I	144_K	2.243	0.25
65_Q	126_F	2.166	0.23
27_V	30_N	2.111	0.23
46_R	145_A	2.078	0.22
116_T	126_F	2.058	0.22
45_F	64_L	2.020	0.21
58_N	89_F	1.851	0.19
55_E	132_R	1.845	0.19
144_K	154_Q	1.809	0.18
43_G	81_P	1.808	0.18
39_D	66_R	1.806	0.18
80_G	84_G	1.804	0.18
94_D	132_R	1.773	0.18
120_H	124_A	1.766	0.18
66_R	75_F	1.752	0.18
36_N	47_P	1.656	0.16
73_V	132_R	1.647	0.16
120_H	127_V	1.634	0.16
55_E	73_V	1.615	0.16
123_A	130_A	1.615	0.16
31_A	57_E	1.592	0.16
57_E	135_S	1.562	0.15
48_G	93_P	1.537	0.15
63_T	154_Q	1.423	0.14
47_P	98_Q	1.369	0.13
34_R	128_P	1.360	0.13
91_L	110_L	1.338	0.13
60_L	154_Q	1.329	0.13
78_S	152_K	1.290	0.12
57_E	141_L	1.256	0.12
49_E	74_D	1.254	0.12
61_G	74_D	1.254	0.12
49_E	61_G	1.254	0.12
108_K	121_A	1.244	0.12
41_A	132_R	1.236	0.12
93_P	99_A	1.223	0.12
119_D	154_Q	1.221	0.12
79_S	138_N	1.216	0.12
45_F	102_I	1.202	0.12
73_V	160_I	1.199	0.12
51_G	101_K	1.197	0.12
52_A	89_F	1.195	0.12
56_L	80_G	1.195	0.12
60_L	158_I	1.194	0.12
112_N	119_D	1.191	0.11
79_S	156_K	1.183	0.11
23_A	37_V	1.175	0.11
102_I	154_Q	1.168	0.11
46_R	132_R	1.164	0.11
48_G	99_A	1.154	0.11
79_S	128_P	1.147	0.11
96_V	142_L	1.143	0.11
75_F	86_T	1.120	0.11
25_N	76_V	1.113	0.11
133_F	159_L	1.108	0.11
31_A	42_V	1.106	0.11
124_A	127_V	1.102	0.11
90_M	120_H	1.093	0.11
46_R	94_D	1.086	0.11
86_T	124_A	1.085	0.11
46_R	83_N	1.085	0.11
64_L	125_D	1.065	0.10
126_F	158_I	1.043	0.10
93_P	131_S	1.039	0.10
49_E	134_L	1.038	0.10
74_D	134_L	1.038	0.10
61_G	134_L	1.038	0.10
48_G	101_K	1.037	0.10
111_N	118_S	1.037	0.10
54_A	150_P	1.035	0.10
29_L	56_L	1.031	0.10
60_L	102_I	1.000	0.10
86_T	109_N	0.999	0.10
105_F	156_K	0.994	0.10
117_L	154_Q	0.969	0.10
32_F	68_P	0.967	0.10
118_S	145_A	0.962	0.10
106_F	142_L	0.950	0.10
88_D	103_N	0.935	0.09
64_L	106_F	0.919	0.09
53_A	79_S	0.899	0.09
53_A	128_P	0.895	0.09
54_A	108_K	0.889	0.09
73_V	145_A	0.889	0.09
78_S	144_K	0.886	0.09
50_A	54_A	0.885	0.09
39_D	84_G	0.882	0.09
35_L	74_D	0.879	0.09
35_L	61_G	0.879	0.09
35_L	49_E	0.879	0.09
77_F	151_Q	0.874	0.09
84_G	88_D	0.862	0.09
83_N	114_M	0.860	0.09
99_A	157_I	0.854	0.09
22_V	146_I	0.849	0.09
21_I	133_F	0.846	0.09
25_N	89_F	0.839	0.09
93_P	101_K	0.838	0.09
23_A	67_A	0.823	0.09
43_G	87_V	0.819	0.09
55_E	62_G	0.817	0.09
88_D	127_V	0.816	0.09
105_F	157_I	0.815	0.09
91_L	113_F	0.808	0.08
22_V	33_D	0.805	0.08
76_V	146_I	0.799	0.08
154_Q	158_I	0.798	0.08
77_F	145_A	0.794	0.08
52_A	152_K	0.791	0.08
77_F	129_L	0.787	0.08
29_L	82_N	0.784	0.08
38_V	135_S	0.784	0.08
61_G	149_L	0.781	0.08
74_D	149_L	0.781	0.08
49_E	149_L	0.781	0.08
103_N	134_L	0.749	0.08
117_L	145_A	0.745	0.08
67_A	73_V	0.737	0.08
102_I	158_I	0.730	0.08
127_V	153_L	0.723	0.08
101_K	121_A	0.719	0.08
54_A	113_F	0.709	0.08
55_E	142_L	0.709	0.08
95_T	139_K	0.699	0.08
131_S	161_K	0.699	0.08
88_D	128_P	0.698	0.08
122_A	143_V	0.697	0.08
72_S	76_V	0.697	0.08
25_N	160_I	0.688	0.08
115_N	145_A	0.687	0.08
45_F	55_E	0.678	0.08
72_S	155_A	0.678	0.08
46_R	118_S	0.675	0.08
115_N	137_A	0.673	0.08
126_F	136_E	0.665	0.08
73_V	126_F	0.663	0.08
65_Q	68_P	0.659	0.08
40_P	58_N	0.652	0.07
102_I	119_D	0.651	0.07
122_A	137_A	0.650	0.07
130_A	134_L	0.649	0.07
58_N	132_R	0.649	0.07
53_A	66_R	0.646	0.07
65_Q	136_E	0.646	0.07
131_S	139_K	0.643	0.07
47_P	150_P	0.643	0.07
35_L	134_L	0.641	0.07
24_S	73_V	0.640	0.07
74_D	103_N	0.636	0.07
61_G	103_N	0.636	0.07
49_E	103_N	0.636	0.07
32_F	60_L	0.629	0.07
23_A	38_V	0.625	0.07
34_R	149_L	0.624	0.07
131_S	159_L	0.622	0.07
40_P	76_V	0.621	0.07
57_E	110_L	0.618	0.07
83_N	89_F	0.616	0.07
53_A	89_F	0.615	0.07
121_A	130_A	0.615	0.07
82_N	146_I	0.612	0.07
83_N	126_F	0.610	0.07
80_G	158_I	0.609	0.07
97_A	107_D	0.605	0.07
78_S	156_K	0.591	0.07
32_F	126_F	0.587	0.07
113_F	154_Q	0.586	0.07
134_L	149_L	0.584	0.07
33_D	81_P	0.583	0.07
50_A	53_A	0.577	0.07
64_L	69_Q	0.575	0.07
99_A	105_F	0.573	0.07
65_Q	73_V	0.572	0.07
44_K	139_K	0.572	0.07
89_F	106_F	0.567	0.07
52_A	73_V	0.567	0.07
94_D	145_A	0.565	0.07
28_D	150_P	0.564	0.07
139_K	160_I	0.561	0.07
120_H	159_L	0.561	0.07
112_N	137_A	0.557	0.07
52_A	128_P	0.557	0.07
53_A	68_P	0.556	0.07
146_I	159_L	0.550	0.07
92_T	125_D	0.543	0.07
90_M	124_A	0.541	0.07
22_V	82_N	0.536	0.07
44_K	87_V	0.533	0.07
143_V	158_I	0.531	0.07
37_V	113_F	0.526	0.07
68_P	136_E	0.525	0.07
64_L	129_L	0.523	0.07
46_R	110_L	0.522	0.07
99_A	106_F	0.521	0.07
67_A	89_F	0.520	0.07
69_Q	147_G	0.516	0.07
64_L	102_I	0.513	0.07
28_D	110_L	0.512	0.07
76_V	135_S	0.509	0.07
73_V	86_T	0.509	0.07
51_G	142_L	0.504	0.07
44_K	81_P	0.502	0.07
22_V	29_L	0.502	0.07
46_R	160_I	0.500	0.07

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2j8p_A	1	0.1988	52.8	0.947	Contact Map
4p1l_A	1	0.7391	20	0.958	Contact Map
2ayu_A	1	0.1491	17	0.959	Contact Map
3k93_A	1	0.9379	15.7	0.96	Contact Map
3zih_A	1	0.3851	14.2	0.961	Contact Map
4ovq_A	1	0.7453	12.4	0.962	Contact Map
3zie_A	1	0.3789	11.4	0.962	Contact Map
3zig_A	1	0.3913	11.1	0.963	Contact Map
4fzv_A	1	0.9503	10.8	0.963	Contact Map
3p04_A	1	0.3975	10.7	0.963	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.