T0915_1_161 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0915_1_161 - T0915 1-161

ID:	79	Sequences: MINVNSTAKDIEGLESYLANGYVEADSFNDPEDDALECLSNLLVKDSRGGLSFCKKILKSNNIDGVFIKGSALNFLLLSEQWSYAFEYLTSNADNITLAELEKALFYFYCAKNETDPYPVPEGLFKKLMKRYEELKNDPDAKFYHLHETYNDFSKAYPLNN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	161 (160)
Sequences:	19 (16)
Seq/√Len:	1.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_D	73_L	2.568	0.19
107_Y	111_A	2.450	0.18
46_D	88_Y	2.269	0.16
73_L	150_Y	2.249	0.16
58_L	135_L	2.226	0.16
85_A	150_Y	2.183	0.15
113_N	155_K	2.157	0.15
35_A	76_L	2.145	0.15
123_G	151_N	2.044	0.14
139_P	161_N	2.028	0.14
39_L	42_L	2.019	0.14
39_L	57_I	2.019	0.14
42_L	57_I	2.019	0.14
9_K	24_E	1.994	0.14
34_D	105_L	1.992	0.14
27_S	31_P	1.931	0.13
55_K	104_A	1.919	0.13
17_Y	84_Y	1.823	0.13
22_Y	60_S	1.784	0.12
107_Y	120_V	1.757	0.12
78_L	110_C	1.714	0.12
14_L	22_Y	1.684	0.12
101_L	157_Y	1.681	0.12
69_K	89_L	1.680	0.12
35_A	104_A	1.670	0.12
56_K	132_Y	1.663	0.11
14_L	21_G	1.654	0.11
49_G	97_T	1.617	0.11
106_F	128_L	1.595	0.11
26_D	32_E	1.595	0.11
111_A	120_V	1.582	0.11
38_C	65_G	1.572	0.11
46_D	150_Y	1.560	0.11
14_L	17_Y	1.525	0.11
54_C	68_I	1.517	0.11
31_P	54_C	1.505	0.10
130_K	135_L	1.500	0.10
38_C	112_K	1.496	0.10
20_N	143_F	1.479	0.10
27_S	54_C	1.479	0.10
10_D	35_A	1.473	0.10
10_D	76_L	1.448	0.10
59_K	137_N	1.427	0.10
105_L	131_R	1.419	0.10
17_Y	131_R	1.407	0.10
25_A	28_F	1.401	0.10
88_Y	124_L	1.391	0.10
112_K	121_P	1.383	0.10
43_L	137_N	1.377	0.10
26_D	47_S	1.357	0.10
33_D	98_L	1.349	0.10
34_D	125_F	1.340	0.09
106_F	112_K	1.331	0.09
5_N	70_G	1.315	0.09
17_Y	60_S	1.308	0.09
86_F	117_P	1.304	0.09
55_K	124_L	1.292	0.09
18_L	108_F	1.286	0.09
65_G	112_K	1.284	0.09
39_L	76_L	1.282	0.09
42_L	76_L	1.282	0.09
57_I	76_L	1.282	0.09
39_L	101_L	1.281	0.09
57_I	101_L	1.281	0.09
42_L	101_L	1.281	0.09
139_P	160_N	1.279	0.09
11_I	26_D	1.255	0.09
132_Y	150_Y	1.254	0.09
46_D	101_L	1.236	0.09
141_A	157_Y	1.227	0.09
42_L	153_F	1.201	0.09
57_I	153_F	1.201	0.09
39_L	153_F	1.201	0.09
8_A	24_E	1.169	0.09
47_S	91_S	1.156	0.08
92_N	113_N	1.147	0.08
27_S	30_D	1.143	0.08
120_V	148_E	1.139	0.08
53_F	127_K	1.137	0.08
79_S	112_K	1.082	0.08
32_E	41_N	1.067	0.08
35_A	101_L	1.059	0.08
53_F	141_A	1.056	0.08
51_L	82_W	1.048	0.08
73_L	124_L	1.044	0.08
105_L	108_F	1.044	0.08
16_S	27_S	1.028	0.08
67_F	92_N	1.026	0.08
26_D	41_N	1.017	0.08
104_A	124_L	1.011	0.08
67_F	134_E	1.010	0.08
67_F	135_L	1.008	0.08
10_D	14_L	1.005	0.08
38_C	64_D	1.002	0.08
87_E	95_N	1.000	0.08
20_N	27_S	0.998	0.08
85_A	141_A	0.993	0.08
21_G	78_L	0.976	0.08
36_L	67_F	0.973	0.08
7_T	45_K	0.971	0.08
9_K	32_E	0.958	0.08
28_F	33_D	0.954	0.08
33_D	50_G	0.953	0.08
35_A	153_F	0.946	0.07
69_K	111_A	0.938	0.07
77_L	111_A	0.922	0.07
18_L	25_A	0.916	0.07
9_K	26_D	0.916	0.07
33_D	81_Q	0.901	0.07
69_K	112_K	0.898	0.07
89_L	112_K	0.890	0.07
18_L	22_Y	0.889	0.07
11_I	32_E	0.886	0.07
77_L	112_K	0.882	0.07
108_F	157_Y	0.882	0.07
7_T	11_I	0.874	0.07
124_L	146_L	0.869	0.07
93_A	100_E	0.867	0.07
22_Y	56_K	0.866	0.07
27_S	50_G	0.859	0.07
89_L	111_A	0.857	0.07
60_S	131_R	0.848	0.07
38_C	96_I	0.840	0.07
73_L	146_L	0.837	0.07
10_D	38_C	0.835	0.07
8_A	87_E	0.827	0.07
125_F	146_L	0.823	0.07
25_A	30_D	0.821	0.07
28_F	98_L	0.821	0.07
72_A	142_K	0.818	0.07
21_G	24_E	0.816	0.07
6_S	158_P	0.808	0.07
69_K	77_L	0.806	0.07
69_K	88_Y	0.804	0.07
131_R	150_Y	0.804	0.07
21_G	80_E	0.793	0.07
34_D	131_R	0.779	0.07
37_E	48_R	0.765	0.07
30_D	54_C	0.762	0.07
14_L	132_Y	0.761	0.07
77_L	89_L	0.757	0.07
81_Q	143_F	0.749	0.07
2_I	144_Y	0.747	0.07
18_L	98_L	0.732	0.07
17_Y	22_Y	0.730	0.07
13_G	18_L	0.729	0.07
19_A	143_F	0.727	0.07
13_G	106_F	0.725	0.07
5_N	105_L	0.719	0.06
12_E	41_N	0.716	0.06
134_E	138_D	0.714	0.06
148_E	152_D	0.710	0.06
10_D	24_E	0.709	0.06
24_E	103_K	0.705	0.06
50_G	54_C	0.702	0.06
121_P	128_L	0.694	0.06
17_Y	21_G	0.684	0.06
85_A	160_N	0.682	0.06
55_K	142_K	0.680	0.06
38_C	76_L	0.679	0.06
115_T	126_K	0.674	0.06
9_K	44_V	0.666	0.06
28_F	31_P	0.664	0.06
111_A	148_E	0.660	0.06
122_E	127_K	0.659	0.06
39_L	132_Y	0.656	0.06
42_L	132_Y	0.656	0.06
57_I	132_Y	0.656	0.06
46_D	70_G	0.651	0.06
128_L	136_K	0.651	0.06
43_L	49_G	0.645	0.06
29_N	80_E	0.642	0.06
89_L	96_I	0.642	0.06
96_I	128_L	0.639	0.06
35_A	124_L	0.638	0.06
4_V	161_N	0.636	0.06
35_A	57_I	0.626	0.06
35_A	42_L	0.626	0.06
35_A	39_L	0.626	0.06
112_K	128_L	0.622	0.06
106_F	110_C	0.619	0.06
31_P	50_G	0.618	0.06
7_T	71_S	0.611	0.06
55_K	88_Y	0.605	0.06
67_F	149_T	0.604	0.06
26_D	66_V	0.601	0.06
49_G	85_A	0.600	0.06
51_L	81_Q	0.600	0.06
125_F	142_K	0.596	0.06
11_I	47_S	0.595	0.06
25_A	56_K	0.592	0.06
96_I	101_L	0.592	0.06
86_F	108_F	0.591	0.06
72_A	84_Y	0.590	0.06
14_L	18_L	0.590	0.06
34_D	115_T	0.586	0.06
83_S	92_N	0.586	0.06
76_L	104_A	0.583	0.06
13_G	128_L	0.577	0.06
149_T	158_P	0.574	0.06
3_N	26_D	0.570	0.06
101_L	124_L	0.569	0.06
54_C	132_Y	0.568	0.06
79_S	121_P	0.568	0.06
106_F	121_P	0.566	0.06
126_K	140_D	0.565	0.06
5_N	125_F	0.561	0.06
65_G	156_A	0.561	0.06
6_S	87_E	0.559	0.06
26_D	60_S	0.559	0.06
116_D	120_V	0.558	0.06
11_I	45_K	0.558	0.06
37_E	130_K	0.557	0.06
31_P	99_A	0.554	0.06
110_C	113_N	0.554	0.06
58_L	152_D	0.550	0.06
67_F	113_N	0.549	0.06
11_I	85_A	0.548	0.06
18_L	38_C	0.541	0.06
18_L	23_V	0.539	0.06
107_Y	112_K	0.535	0.06
122_E	155_K	0.534	0.06
53_F	124_L	0.528	0.06
32_E	74_N	0.527	0.06
56_K	156_A	0.524	0.06
53_F	121_P	0.522	0.06
126_K	144_Y	0.520	0.06
34_D	82_W	0.520	0.06
6_S	19_A	0.518	0.06
54_C	150_Y	0.516	0.06
69_K	114_E	0.514	0.06
14_L	84_Y	0.514	0.06
80_E	92_N	0.513	0.06
109_Y	140_D	0.511	0.06
106_F	136_K	0.510	0.06
34_D	142_K	0.508	0.06
5_N	158_P	0.506	0.06
91_S	141_A	0.505	0.06
134_E	139_P	0.505	0.06
89_L	107_Y	0.500	0.06

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5a1u_G	1	0.9441	18.3	0.955	Contact Map
5byh_M	1	0.913	11.4	0.959	Contact Map
2nn6_G	1	0.3416	10.7	0.96	Contact Map
2m7l_A	1	0.7888	9.3	0.961	Contact Map
4rku_N	1	0.2298	8.3	0.962	Contact Map
2v7s_A	1	0.2609	8.1	0.962	Contact Map
4gkp_A	1	0.3851	4.9	0.965	Contact Map
1t35_A	1	0.2609	4.6	0.966	Contact Map
1xzp_A	1	0.4658	4.3	0.966	Contact Map
3u0k_A	1	0.0745	4.2	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.