T0884_1_75 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0884_1_75 - T0884 1-75

ID:	31	Sequences: RGPSNGQSVLENSVQVKETSPRRVSVDPQTGEFVVFDRTLGDVYHGHVRAWKDLTSDMQNALVRGGYVDRKGNPK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (65)
Sequences:	202 (138)
Seq/√Len:	17.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_V	49_R	4.508	1.00
3_P	46_G	2.893	0.98
7_Q	13_S	2.846	0.98
13_S	58_M	2.820	0.98
47_H	60_N	2.456	0.95
21_P	28_P	2.251	0.92
6_G	9_V	1.850	0.82
69_D	73_N	1.586	0.71
50_A	56_S	1.571	0.70
4_S	46_G	1.474	0.65
10_L	60_N	1.463	0.65
59_Q	68_V	1.421	0.62
51_W	68_V	1.363	0.59
37_D	47_H	1.316	0.56
24_V	37_D	1.313	0.56
7_Q	58_M	1.285	0.54
36_F	60_N	1.270	0.53
23_R	27_D	1.244	0.52
54_L	74_P	1.220	0.50
70_R	75_K	1.211	0.50
11_E	73_N	1.200	0.49
62_L	65_G	1.154	0.46
52_K	59_Q	1.142	0.46
61_A	68_V	1.121	0.45
70_R	73_N	1.110	0.44
15_Q	23_R	1.085	0.42
5_N	46_G	1.042	0.40
28_P	31_G	1.023	0.39
4_S	15_Q	1.022	0.39
17_K	53_D	1.012	0.38
52_K	68_V	0.985	0.37
31_G	69_D	0.985	0.37
18_E	34_V	0.984	0.37
10_L	35_V	0.982	0.37
26_V	52_K	0.981	0.36
18_E	31_G	0.962	0.35
18_E	29_Q	0.958	0.35
34_V	67_Y	0.954	0.35
30_T	56_S	0.942	0.34
47_H	65_G	0.938	0.34
50_A	59_Q	0.915	0.33
30_T	59_Q	0.882	0.31
46_G	67_Y	0.880	0.31
33_F	52_K	0.872	0.31
9_V	57_D	0.869	0.30
10_L	15_Q	0.865	0.30
31_G	60_N	0.855	0.30
29_Q	58_M	0.829	0.28
23_R	46_G	0.820	0.28
15_Q	18_E	0.810	0.28
28_P	65_G	0.808	0.27
36_F	63_V	0.800	0.27
23_R	53_D	0.780	0.26
50_A	61_A	0.780	0.26
71_K	74_P	0.777	0.26
23_R	47_H	0.751	0.25
33_F	50_A	0.748	0.25
30_T	68_V	0.745	0.25
51_W	59_Q	0.744	0.25
54_L	67_Y	0.743	0.24
16_V	54_L	0.724	0.24
10_L	47_H	0.718	0.23
50_A	68_V	0.715	0.23
28_P	33_F	0.704	0.23
15_Q	20_S	0.703	0.23
2_G	46_G	0.694	0.22
21_P	29_Q	0.677	0.22
20_S	61_A	0.672	0.21
19_T	61_A	0.672	0.21
32_E	71_K	0.669	0.21
16_V	70_R	0.667	0.21
11_E	35_V	0.662	0.21
7_Q	11_E	0.653	0.21
33_F	59_Q	0.651	0.21
33_F	68_V	0.643	0.20
26_V	32_E	0.638	0.20
30_T	33_F	0.632	0.20
68_V	71_K	0.632	0.20
17_K	24_V	0.628	0.20
7_Q	10_L	0.620	0.19
53_D	58_M	0.619	0.19
23_R	37_D	0.615	0.19
31_G	47_H	0.611	0.19
18_E	37_D	0.608	0.19
9_V	23_R	0.606	0.19
67_Y	70_R	0.604	0.19
55_T	66_G	0.602	0.19
29_Q	48_V	0.594	0.18
17_K	62_L	0.593	0.18
48_V	66_G	0.593	0.18
55_T	68_V	0.588	0.18
29_Q	60_N	0.578	0.18
27_D	36_F	0.570	0.18
30_T	58_M	0.547	0.17
11_E	69_D	0.536	0.16
51_W	72_G	0.529	0.16
30_T	71_K	0.515	0.16
31_G	62_L	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2b5u_A	1	0.88	99.7	0.343	Contact Map
2fhz_B	1	0.84	99.3	0.499	Contact Map
3jb9_S	1	0.5867	5.9	0.914	Contact Map
1vyk_A	1	0.64	3.4	0.924	Contact Map
2o55_A	1	0.8133	3.2	0.924	Contact Map
3mz2_A	1	0.96	3.1	0.925	Contact Map
3luu_A	1	0.5333	3	0.925	Contact Map
3i10_A	1	0.96	3	0.925	Contact Map
2pz0_A	1	0.92	2.9	0.926	Contact Map
3nuh_B	1	0.6	2.9	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.