T0883_1_237 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0883_1_237 - T0883 1-237

ID:	29	Sequences: MKKEKNDPTTPGTTTTVIPLQTTVQTPITLGSANNFAVIAGSSVTNTGATNITGDLGLSPGTSIGGFPPGILNGTLHINDAIANQAKLDITTAYNDAAARVASDMVTISGNIGGLTLTPGLYKSTSSLAVSSGDVTFDALGDPSAIFVIQIASTLTTTPGRKVLLSGGALASNIYWQVSSSASFGTTTSFKGTVIALESITFDTGATLEGRALARNGAVTMEGNTFVLPLEHHHHHH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	237 (204)
Sequences:	2659 (1828)
Seq/√Len:	128.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_H	80_D	5.032	1.00
96_D	100_R	3.723	1.00
208_L	212_A	3.622	1.00
59_S	84_N	3.092	1.00
202_F	212_A	2.648	1.00
206_A	224_N	2.602	1.00
43_S	61_G	2.512	1.00
36_F	82_I	2.442	1.00
103_S	123_K	2.435	1.00
43_S	58_L	2.391	1.00
165_L	169_A	2.371	1.00
204_T	222_E	2.323	1.00
191_K	209_E	2.292	1.00
100_R	148_V	2.284	1.00
91_T	95_N	2.193	1.00
197_L	216_N	2.131	1.00
85_Q	89_D	2.030	1.00
124_S	128_L	2.027	1.00
159_P	185_G	2.000	1.00
198_E	216_N	1.999	1.00
90_I	215_R	1.994	1.00
160_G	187_T	1.990	1.00
32_S	89_D	1.924	1.00
137_F	149_I	1.893	1.00
139_A	145_A	1.888	1.00
157_T	188_T	1.871	1.00
90_I	213_L	1.838	1.00
193_T	211_R	1.807	1.00
98_A	177_Q	1.799	1.00
67_F	70_G	1.799	1.00
142_D	145_A	1.787	1.00
42_S	218_A	1.733	1.00
117_L	135_V	1.719	1.00
159_P	186_T	1.705	1.00
84_N	88_L	1.621	1.00
138_D	166_S	1.616	1.00
200_I	212_A	1.593	1.00
134_D	164_L	1.588	1.00
113_G	132_S	1.582	1.00
37_A	52_I	1.566	1.00
36_F	57_G	1.561	1.00
85_Q	88_L	1.549	1.00
36_F	77_H	1.531	1.00
97_A	195_I	1.527	1.00
127_S	154_T	1.526	1.00
134_D	162_K	1.525	1.00
58_L	61_G	1.517	1.00
44_V	56_L	1.498	1.00
123_K	150_Q	1.490	1.00
72_L	76_L	1.490	1.00
186_T	204_T	1.478	1.00
79_N	84_N	1.440	1.00
64_I	78_I	1.428	1.00
28_I	97_A	1.419	1.00
58_L	78_I	1.404	1.00
202_F	208_L	1.399	1.00
53_T	73_N	1.391	1.00
92_T	95_N	1.380	1.00
182_A	196_A	1.357	1.00
184_F	194_V	1.324	1.00
187_T	205_G	1.323	1.00
203_D	222_E	1.320	1.00
94_Y	177_Q	1.303	1.00
184_F	188_T	1.303	1.00
47_T	222_E	1.296	1.00
186_T	203_D	1.285	1.00
132_S	158_T	1.277	1.00
197_L	215_R	1.274	1.00
90_I	195_I	1.273	1.00
140_L	145_A	1.262	1.00
56_L	72_L	1.256	1.00
128_L	151_I	1.253	1.00
204_T	223_G	1.227	1.00
43_S	218_A	1.226	1.00
43_S	65_G	1.223	0.99
157_T	161_R	1.217	0.99
49_A	223_G	1.210	0.99
190_F	194_V	1.206	0.99
129_A	156_T	1.205	0.99
118_T	140_L	1.203	0.99
138_D	142_D	1.202	0.99
199_S	217_G	1.197	0.99
58_L	62_T	1.177	0.99
126_S	152_A	1.171	0.99
147_F	169_A	1.161	0.99
91_T	215_R	1.161	0.99
106_V	125_T	1.157	0.99
162_K	189_S	1.149	0.99
25_Q	100_R	1.140	0.99
108_I	112_I	1.139	0.99
58_L	79_N	1.134	0.99
26_T	100_R	1.127	0.99
138_D	145_A	1.069	0.99
37_A	54_G	1.056	0.99
101_V	121_L	1.047	0.98
118_T	147_F	1.027	0.98
41_G	87_K	1.010	0.98
202_F	224_N	1.006	0.98
37_A	73_N	0.999	0.98
125_T	152_A	0.991	0.98
181_S	199_S	0.989	0.98
90_I	97_A	0.970	0.97
46_N	50_T	0.964	0.97
137_F	174_I	0.962	0.97
139_A	169_A	0.960	0.97
108_I	115_L	0.956	0.97
108_I	124_S	0.952	0.97
29_T	96_D	0.951	0.97
131_S	161_R	0.943	0.97
108_I	128_L	0.935	0.97
201_T	222_E	0.921	0.96
48_G	71_I	0.920	0.96
221_M	224_N	0.915	0.96
103_S	150_Q	0.912	0.96
134_D	161_R	0.907	0.96
139_A	165_L	0.904	0.96
159_P	203_D	0.904	0.96
161_R	188_T	0.904	0.96
131_S	158_T	0.896	0.96
62_T	79_N	0.894	0.96
150_Q	177_Q	0.894	0.96
46_N	70_G	0.889	0.96
33_A	195_I	0.885	0.96
59_S	87_K	0.881	0.95
136_T	164_L	0.877	0.95
180_S	197_L	0.875	0.95
33_A	93_A	0.870	0.95
55_D	77_H	0.864	0.95
95_N	98_A	0.855	0.95
141_G	145_A	0.853	0.95
111_N	132_S	0.851	0.95
155_L	190_F	0.849	0.94
39_I	57_G	0.842	0.94
212_A	226_F	0.834	0.94
64_I	70_G	0.834	0.94
46_N	223_G	0.833	0.94
139_A	166_S	0.833	0.94
88_L	92_T	0.832	0.94
40_A	58_L	0.830	0.94
129_A	132_S	0.829	0.94
154_T	183_S	0.826	0.94
38_V	219_V	0.824	0.94
95_N	99_A	0.821	0.93
163_V	176_W	0.819	0.93
153_S	180_S	0.818	0.93
64_I	67_F	0.814	0.93
56_L	76_L	0.812	0.93
141_G	167_G	0.810	0.93
113_G	158_T	0.808	0.93
107_T	124_S	0.807	0.93
77_H	83_A	0.807	0.93
58_L	63_S	0.805	0.93
43_S	63_S	0.803	0.93
63_S	78_I	0.798	0.92
110_G	125_T	0.796	0.92
88_L	91_T	0.791	0.92
43_S	62_T	0.791	0.92
64_I	76_L	0.790	0.92
116_T	138_D	0.790	0.92
30_L	33_A	0.790	0.92
109_S	124_S	0.789	0.92
100_R	146_I	0.787	0.92
37_A	53_T	0.785	0.92
27_P	173_N	0.784	0.92
59_S	79_N	0.782	0.92
58_L	83_A	0.775	0.91
93_A	195_I	0.773	0.91
191_K	207_T	0.769	0.91
171_A	209_E	0.766	0.91
37_A	226_F	0.757	0.90
165_L	171_A	0.753	0.90
135_V	163_V	0.752	0.90
56_L	64_I	0.746	0.90
129_A	158_T	0.744	0.90
42_S	198_E	0.741	0.89
96_D	99_A	0.740	0.89
139_A	142_D	0.738	0.89
28_I	146_I	0.738	0.89
138_D	167_G	0.730	0.89
124_S	151_I	0.728	0.88
119_P	140_L	0.724	0.88
151_I	178_V	0.720	0.88
32_S	85_Q	0.715	0.88
87_K	215_R	0.715	0.88
201_T	218_A	0.714	0.88
81_A	85_Q	0.709	0.87
140_L	167_G	0.709	0.87
185_G	203_D	0.707	0.87
156_T	178_V	0.703	0.87
30_L	93_A	0.702	0.87
51_N	73_N	0.700	0.86
204_T	224_N	0.698	0.86
94_Y	98_A	0.693	0.86
35_N	55_D	0.687	0.85
202_F	206_A	0.686	0.85
101_V	105_M	0.686	0.85
184_F	202_F	0.679	0.85
42_S	61_G	0.678	0.85
119_P	145_A	0.673	0.84
194_V	212_A	0.672	0.84
139_A	167_G	0.672	0.84
41_G	91_T	0.666	0.84
48_G	223_G	0.664	0.83
87_K	91_T	0.659	0.83
33_A	39_I	0.658	0.83
76_L	83_A	0.658	0.83
154_T	181_S	0.655	0.83
187_T	204_T	0.653	0.82
195_I	215_R	0.649	0.82
67_F	71_I	0.648	0.82
107_T	110_G	0.648	0.82
82_I	85_Q	0.646	0.82
101_V	104_D	0.646	0.82
132_S	161_R	0.645	0.82
97_A	146_I	0.639	0.81
171_A	211_R	0.635	0.81
127_S	151_I	0.634	0.81
200_I	213_L	0.634	0.81
96_D	148_V	0.632	0.80
79_N	83_A	0.628	0.80
158_T	161_R	0.625	0.80
40_A	87_K	0.625	0.80
155_L	178_V	0.622	0.79
144_S	170_L	0.618	0.79
115_L	119_P	0.618	0.79
170_L	173_N	0.617	0.79
38_V	44_V	0.614	0.78
109_S	123_K	0.614	0.78
184_F	208_L	0.610	0.78
43_S	78_I	0.607	0.78
157_T	185_G	0.606	0.78
175_Y	205_G	0.606	0.78
149_I	176_W	0.606	0.78
154_T	203_D	0.603	0.77
27_P	175_Y	0.603	0.77
181_S	198_E	0.600	0.77
104_D	108_I	0.599	0.77
52_I	56_L	0.596	0.76
27_P	100_R	0.595	0.76
172_S	209_E	0.594	0.76
91_T	197_L	0.592	0.76
142_D	170_L	0.590	0.76
41_G	198_E	0.587	0.75
77_H	82_I	0.586	0.75
157_T	184_F	0.585	0.75
44_V	64_I	0.584	0.75
159_P	187_T	0.584	0.75
189_S	207_T	0.583	0.75
157_T	190_F	0.581	0.75
145_A	167_G	0.579	0.74
41_G	213_L	0.578	0.74
106_V	123_K	0.577	0.74
41_G	216_N	0.576	0.74
146_I	175_Y	0.574	0.74
128_L	152_A	0.574	0.74
51_N	70_G	0.574	0.74
173_N	193_T	0.573	0.74
104_D	121_L	0.571	0.73
41_G	215_R	0.571	0.73
111_N	129_A	0.569	0.73
146_I	173_N	0.567	0.73
176_W	211_R	0.565	0.73
104_D	107_T	0.562	0.72
68_P	71_I	0.561	0.72
111_N	158_T	0.560	0.72
31_G	92_T	0.560	0.72
106_V	109_S	0.559	0.72
113_G	131_S	0.557	0.71
87_K	90_I	0.556	0.71
112_I	151_I	0.548	0.70
28_I	96_D	0.546	0.70
202_F	226_F	0.543	0.70
111_N	115_L	0.541	0.69
154_T	180_S	0.540	0.69
104_D	118_T	0.537	0.69
173_N	211_R	0.534	0.68
182_A	194_V	0.533	0.68
124_S	129_A	0.533	0.68
45_T	220_T	0.532	0.68
31_G	89_D	0.531	0.68
50_T	224_N	0.530	0.68
42_S	87_K	0.525	0.67
23_T	26_T	0.524	0.67
187_T	203_D	0.523	0.67
171_A	193_T	0.522	0.67
27_P	97_A	0.519	0.66
125_T	129_A	0.519	0.66
207_T	225_T	0.518	0.66
59_S	88_L	0.517	0.66
94_Y	179_S	0.516	0.66
105_M	123_K	0.515	0.66
107_T	128_L	0.511	0.65
154_T	178_V	0.511	0.65
135_V	147_F	0.511	0.65
110_G	115_L	0.511	0.65
127_S	153_S	0.510	0.65
92_T	96_D	0.506	0.64
98_A	150_Q	0.505	0.64
198_E	217_G	0.505	0.64
46_N	67_F	0.503	0.64
154_T	218_A	0.502	0.64
154_T	196_A	0.502	0.64
123_K	151_I	0.501	0.63
147_F	173_N	0.501	0.63
124_S	152_A	0.501	0.63
184_F	206_A	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3uyu_A	1	0.8903	100	0.184	Contact Map
3vn3_A	1	0.8523	100	0.187	Contact Map
4nu3_A	1	0.8692	100	0.188	Contact Map
4nuh_A	1	0.8523	100	0.204	Contact Map
3wp9_A	1	0.8861	100	0.205	Contact Map
4om9_A	1	0.8608	35.1	0.951	Contact Map
2lq1_A	1	0.097	19.4	0.957	Contact Map
1wxr_A	1	0.8776	9.1	0.963	Contact Map
4peu_A	1	0.5992	4.2	0.968	Contact Map
3zsc_A	1	0.6203	3.9	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.