T0947_69_214 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0947_69_214 - T0947 69-214

ID:	130	Sequences: QREGLNIERIVVSKDKRQLYLVSGDTLLRTYTVAFGWNFIGHKQFEGDGKTPEGIYSIDYKNPKSQFTKSLHVDYPNKADIAYAKSQGRSPGGDIMIHGLPSNPQKYERISKIHPYDWTLGCIAVTNKEIEEIYALVKERTLVEVC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	146 (135)
Sequences:	2263 (1444)
Seq/√Len:	124.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_R	132_E	3.954	1.00
31_Y	132_E	3.851	1.00
22_V	27_L	2.945	1.00
55_I	144_E	2.898	1.00
14_K	53_E	2.784	1.00
45_F	89_R	2.777	1.00
18_Q	30_T	2.674	1.00
17_R	117_D	2.610	1.00
20_Y	27_L	2.591	1.00
55_I	142_L	2.519	1.00
125_V	133_I	2.470	1.00
9_R	144_E	2.445	1.00
132_E	136_L	2.342	1.00
37_W	49_G	2.261	1.00
61_K	134_Y	2.234	1.00
42_H	53_E	2.127	1.00
61_K	139_E	1.991	1.00
84_A	131_E	1.906	1.00
11_V	146_C	1.906	1.00
17_R	35_F	1.888	1.00
20_Y	30_T	1.810	1.00
13_S	146_C	1.783	1.00
126_T	129_E	1.781	1.00
13_S	16_K	1.757	1.00
12_V	143_V	1.651	1.00
69_K	131_E	1.636	1.00
70_S	96_M	1.636	1.00
58_I	71_L	1.606	1.00
45_F	83_Y	1.564	1.00
12_V	33_V	1.529	1.00
68_T	131_E	1.478	1.00
10_I	21_L	1.446	1.00
19_L	33_V	1.441	1.00
49_G	120_L	1.439	1.00
78_K	82_A	1.437	1.00
45_F	87_Q	1.409	1.00
83_Y	87_Q	1.369	1.00
58_I	87_Q	1.361	1.00
33_V	125_V	1.329	1.00
97_I	130_I	1.284	1.00
57_S	142_L	1.282	1.00
105_Q	114_H	1.280	1.00
44_Q	83_Y	1.263	1.00
59_D	72_H	1.252	1.00
38_N	50_K	1.226	0.99
32_T	129_E	1.217	0.99
77_N	80_D	1.213	0.99
13_S	20_Y	1.209	0.99
78_K	81_I	1.203	0.99
18_Q	32_T	1.188	0.99
44_Q	87_Q	1.181	0.99
83_Y	86_S	1.176	0.99
86_S	96_M	1.149	0.99
62_N	65_S	1.144	0.99
11_V	20_Y	1.134	0.99
137_V	141_T	1.113	0.99
62_N	70_S	1.107	0.99
114_H	126_T	1.089	0.99
61_K	138_K	1.087	0.99
119_T	124_A	1.059	0.98
31_Y	129_E	1.041	0.98
58_I	143_V	1.033	0.98
23_S	28_L	1.029	0.98
10_I	137_V	1.011	0.98
35_F	117_D	0.999	0.98
12_V	123_I	0.963	0.97
51_T	123_I	0.950	0.97
46_E	93_G	0.938	0.97
97_I	143_V	0.935	0.96
41_G	50_K	0.916	0.96
16_K	20_Y	0.913	0.96
7_I	142_L	0.911	0.96
21_L	136_L	0.911	0.96
14_K	117_D	0.901	0.96
51_T	56_Y	0.891	0.95
11_V	22_V	0.883	0.95
100_L	103_N	0.877	0.95
36_G	51_T	0.872	0.95
104_P	114_H	0.864	0.95
8_E	23_S	0.859	0.94
97_I	125_V	0.855	0.94
14_K	35_F	0.851	0.94
60_Y	72_H	0.848	0.94
34_A	114_H	0.845	0.94
46_E	49_G	0.842	0.94
119_T	125_V	0.834	0.93
83_Y	89_R	0.831	0.93
9_R	55_I	0.830	0.93
81_I	85_K	0.817	0.93
7_I	23_S	0.813	0.93
46_E	90_S	0.812	0.92
72_H	96_M	0.795	0.92
71_L	97_I	0.793	0.92
42_H	50_K	0.792	0.92
24_G	27_L	0.781	0.91
63_P	134_Y	0.773	0.91
9_R	142_L	0.772	0.90
62_N	125_V	0.763	0.90
84_A	91_P	0.762	0.90
43_K	46_E	0.753	0.89
9_R	22_V	0.752	0.89
37_W	120_L	0.745	0.89
8_E	21_L	0.745	0.89
88_G	96_M	0.744	0.89
62_N	96_M	0.741	0.89
74_D	77_N	0.735	0.88
27_L	30_T	0.735	0.88
60_Y	139_E	0.731	0.88
34_A	115_P	0.730	0.88
19_L	97_I	0.728	0.88
34_A	100_L	0.726	0.88
79_A	83_Y	0.720	0.87
125_V	129_E	0.712	0.87
32_T	116_Y	0.702	0.86
34_A	116_Y	0.701	0.86
40_I	46_E	0.696	0.85
125_V	130_I	0.695	0.85
31_Y	125_V	0.694	0.85
34_A	118_W	0.693	0.85
101_P	114_H	0.692	0.85
87_Q	90_S	0.688	0.85
39_F	53_E	0.686	0.84
19_L	133_I	0.681	0.84
62_N	134_Y	0.679	0.84
51_T	95_I	0.677	0.84
68_T	130_I	0.676	0.84
95_I	123_I	0.675	0.84
10_I	58_I	0.669	0.83
102_S	105_Q	0.666	0.83
82_A	86_S	0.665	0.83
102_S	127_N	0.664	0.83
73_V	76_P	0.659	0.82
61_K	137_V	0.644	0.81
105_Q	118_W	0.644	0.81
52_P	96_M	0.643	0.80
29_R	136_L	0.641	0.80
9_R	24_G	0.639	0.80
19_L	129_E	0.637	0.80
53_E	92_G	0.635	0.80
44_Q	85_K	0.627	0.79
22_V	43_K	0.623	0.78
73_V	77_N	0.620	0.78
60_Y	94_D	0.616	0.78
47_G	92_G	0.614	0.77
14_K	43_K	0.602	0.76
100_L	114_H	0.595	0.75
67_F	115_P	0.593	0.75
60_Y	96_M	0.593	0.75
100_L	115_P	0.592	0.75
56_Y	59_D	0.591	0.75
104_P	115_P	0.587	0.74
14_K	40_I	0.586	0.74
56_Y	77_N	0.586	0.74
52_P	56_Y	0.584	0.74
59_D	141_T	0.584	0.74
62_N	72_H	0.576	0.73
75_Y	92_G	0.576	0.73
80_D	83_Y	0.569	0.72
44_Q	115_P	0.567	0.72
40_I	45_F	0.566	0.71
75_Y	95_I	0.566	0.71
5_L	10_I	0.564	0.71
46_E	92_G	0.557	0.70
48_D	92_G	0.555	0.70
56_Y	92_G	0.553	0.70
102_S	114_H	0.551	0.69
100_L	127_N	0.551	0.69
7_I	11_V	0.551	0.69
42_H	83_Y	0.548	0.69
40_I	44_Q	0.547	0.69
79_A	82_A	0.547	0.69
43_K	47_G	0.545	0.69
56_Y	62_N	0.544	0.69
52_P	88_G	0.544	0.69
10_I	20_Y	0.543	0.68
40_I	53_E	0.541	0.68
44_Q	79_A	0.537	0.68
34_A	101_P	0.534	0.67
100_L	120_L	0.532	0.67
71_L	76_P	0.529	0.66
17_R	36_G	0.526	0.66
22_V	25_D	0.526	0.66
14_K	50_K	0.523	0.66
62_N	94_D	0.521	0.65
33_V	123_I	0.521	0.65
51_T	145_V	0.519	0.65
89_R	143_V	0.517	0.65
48_D	62_N	0.516	0.64
101_P	105_Q	0.516	0.64
85_K	88_G	0.513	0.64
116_Y	126_T	0.513	0.64
32_T	85_K	0.512	0.64
14_K	69_K	0.511	0.64
123_I	145_V	0.509	0.63
115_P	126_T	0.508	0.63
8_E	25_D	0.508	0.63
43_K	77_N	0.507	0.63
127_N	137_V	0.506	0.63
35_F	39_F	0.506	0.63
14_K	39_F	0.501	0.62
21_L	125_V	0.501	0.62
31_Y	136_L	0.500	0.62

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xzz_A	1	0.911	100	0.335	Contact Map
4lzh_A	1	0.8288	100	0.362	Contact Map
4jmn_A	1	0.8836	99.9	0.38	Contact Map
4xvo_A	1	0.8836	99.9	0.381	Contact Map
4z7a_A	1	0.8356	99.9	0.385	Contact Map
4qrb_A	1	0.8219	99.9	0.389	Contact Map
4k73_A	1	0.8356	99.9	0.39	Contact Map
3vyp_A	1	0.8767	99.9	0.394	Contact Map
1zat_A	1	0.8493	99.9	0.397	Contact Map
4lpq_A	1	0.863	99.9	0.41	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.