T0945_303_409 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0945_303_409 - T0945 303-409

ID:	121	Sequences: HRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHERNLTLLLLLLQILGSAITFSIRYQLVRLFYDV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	107 (104)
Sequences:	338 (261)
Seq/√Len:	25.6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_N	14_E	4.106	1.00
66_L	85_L	2.592	0.99
91_A	95_S	2.497	0.99
15_M	68_K	2.460	0.99
90_S	98_Y	2.424	0.99
70_L	81_L	2.368	0.98
36_A	41_L	2.187	0.97
19_K	56_E	2.186	0.97
37_E	46_Q	2.136	0.97
45_H	56_E	2.112	0.97
6_L	11_G	2.060	0.96
94_F	98_Y	2.057	0.96
42_V	60_M	2.020	0.95
73_I	81_L	1.989	0.95
63_I	82_L	1.860	0.93
12_K	72_P	1.816	0.92
90_S	94_F	1.645	0.88
90_S	93_T	1.640	0.87
40_Q	69_V	1.639	0.87
83_L	104_F	1.588	0.86
26_S	30_T	1.584	0.86
3_I	87_I	1.569	0.85
70_L	73_I	1.537	0.84
82_L	101_V	1.487	0.82
11_G	74_H	1.480	0.81
15_M	67_L	1.479	0.81
1_H	4_P	1.434	0.79
34_K	46_Q	1.415	0.78
33_L	44_V	1.366	0.76
60_M	63_I	1.321	0.73
10_T	14_E	1.308	0.72
99_Q	102_R	1.291	0.71
29_G	32_I	1.270	0.70
57_C	70_L	1.262	0.70
8_I	14_E	1.259	0.69
33_L	42_V	1.246	0.69
63_I	79_T	1.208	0.66
13_L	100_L	1.204	0.66
75_E	86_Q	1.184	0.65
95_S	99_Q	1.178	0.64
5_R	58_N	1.167	0.63
60_M	89_G	1.131	0.61
9_K	12_K	1.085	0.58
59_N	75_E	1.073	0.57
13_L	89_G	1.070	0.57
18_S	26_S	1.061	0.56
54_F	60_M	1.056	0.56
62_L	96_I	1.024	0.53
61_T	75_E	0.985	0.50
67_L	92_I	0.983	0.50
56_E	63_I	0.981	0.50
43_T	58_N	0.977	0.50
98_Y	105_Y	0.972	0.49
47_S	51_D	0.967	0.49
18_S	79_T	0.960	0.49
89_G	94_F	0.958	0.48
27_F	55_T	0.943	0.47
65_L	69_V	0.928	0.46
87_I	90_S	0.927	0.46
88_L	92_I	0.922	0.46
59_N	64_N	0.918	0.46
61_T	64_N	0.912	0.45
36_A	40_Q	0.912	0.45
27_F	30_T	0.910	0.45
71_G	75_E	0.901	0.44
17_Y	20_F	0.886	0.43
75_E	78_L	0.878	0.43
93_T	99_Q	0.870	0.42
69_V	73_I	0.865	0.42
92_I	95_S	0.854	0.41
96_I	105_Y	0.847	0.40
15_M	58_N	0.846	0.40
60_M	94_F	0.840	0.40
62_L	83_L	0.817	0.38
7_N	10_T	0.814	0.38
31_F	34_K	0.806	0.38
89_G	98_Y	0.800	0.37
97_R	101_V	0.800	0.37
94_F	102_R	0.792	0.37
7_N	35_V	0.790	0.36
35_V	53_E	0.783	0.36
15_M	42_V	0.782	0.36
26_S	29_G	0.780	0.36
20_F	25_L	0.779	0.36
59_N	86_Q	0.776	0.36
17_Y	56_E	0.769	0.35
61_T	86_Q	0.768	0.35
44_V	88_L	0.766	0.35
59_N	67_L	0.763	0.35
90_S	97_R	0.757	0.34
61_T	67_L	0.755	0.34
15_M	57_C	0.752	0.34
64_N	75_E	0.749	0.34
5_R	34_K	0.744	0.33
11_G	46_Q	0.726	0.32
18_S	33_L	0.709	0.31
68_K	74_H	0.703	0.31
28_L	32_I	0.703	0.31
24_S	30_T	0.699	0.31
50_E	103_L	0.699	0.31
26_S	32_I	0.686	0.30
27_F	37_E	0.685	0.30
37_E	44_V	0.684	0.30
47_S	52_G	0.679	0.29
40_Q	47_S	0.678	0.29
52_G	58_N	0.677	0.29
42_V	91_A	0.674	0.29
25_L	29_G	0.670	0.29
74_H	98_Y	0.666	0.29
66_L	81_L	0.664	0.28
3_I	20_F	0.660	0.28
24_S	27_F	0.650	0.28
62_L	89_G	0.642	0.27
62_L	70_L	0.642	0.27
11_G	63_I	0.642	0.27
32_I	36_A	0.640	0.27
23_K	39_L	0.638	0.27
20_F	96_I	0.638	0.27
50_E	100_L	0.637	0.27
61_T	78_L	0.624	0.26
38_S	50_E	0.622	0.26
71_G	86_Q	0.619	0.26
84_L	88_L	0.615	0.26
59_N	78_L	0.613	0.25
93_T	97_R	0.613	0.25
36_A	92_I	0.599	0.25
39_L	42_V	0.598	0.25
78_L	86_Q	0.593	0.24
25_L	30_T	0.589	0.24
73_I	80_L	0.589	0.24
43_T	68_K	0.588	0.24
34_K	47_S	0.583	0.24
13_L	87_I	0.580	0.24
67_L	75_E	0.576	0.23
32_I	40_Q	0.574	0.23
86_Q	97_R	0.572	0.23
28_L	31_F	0.568	0.23
59_N	71_G	0.565	0.23
26_S	73_I	0.564	0.23
34_K	50_E	0.556	0.22
47_S	53_E	0.555	0.22
36_A	62_L	0.553	0.22
93_T	103_L	0.549	0.22
34_K	37_E	0.545	0.22
12_K	65_L	0.536	0.21
32_I	45_H	0.534	0.21
81_L	85_L	0.525	0.21
11_G	30_T	0.522	0.21
13_L	60_M	0.519	0.21
68_K	76_R	0.516	0.20
3_I	84_L	0.515	0.20
33_L	37_E	0.511	0.20
61_T	71_G	0.510	0.20
5_R	11_G	0.502	0.20
42_V	46_Q	0.501	0.20
21_K	28_L	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2k44_A	1	0.2617	6	0.938	Contact Map
1wdc_A	1	0.2523	5.5	0.939	Contact Map
4h0e_A	1	0.4112	2.9	0.947	Contact Map
1x4w_A	1	0.215	2.7	0.948	Contact Map
2qc7_A	1	0.6542	2.2	0.95	Contact Map
4lzx_B	1	0.3458	2.1	0.951	Contact Map
3c5n_A	1	0.7757	2	0.951	Contact Map
3waj_A	1	0.2243	2	0.951	Contact Map
1ow3_A	1	0.8505	1.9	0.952	Contact Map
4buj_A	1	0.0654	1.8	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.