T0939_1_212 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0939_1_212 - T0939 1-212

ID:	109	Sequences: MSEDLRVGLFPVRYLVGTGLPGAPQLVLDLMVDTVDHSVVGRAAVSQAVSPPLNFHADVWGSYVFRLGPPPRRDGSGAIVQISLQGNQGGPQSNSMITFYGELLLKGDGKTGVASYRYYSNGSWHEVENVPVKADPELVPIEPGPVIGQSSMSAIGSAAMYGVAIQSAAASGDLAHMRTLSAYARQQLESRDEIAAALSELKAEIAKLESRQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	212 (195)
Sequences:	62 (34)
Seq/√Len:	2.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
58_D	87_N	5.019	0.81
171_S	188_L	3.001	0.40
49_V	194_I	2.986	0.40
43_A	166_Q	2.697	0.34
46_S	180_L	2.624	0.33
31_M	80_V	2.615	0.32
205_I	209_E	2.501	0.30
125_H	210_S	2.396	0.28
51_P	178_R	2.067	0.23
45_V	53_L	2.024	0.22
63_Y	175_A	2.016	0.22
204_E	209_E	1.978	0.21
202_K	210_S	1.972	0.21
58_D	170_A	1.964	0.21
58_D	90_G	1.952	0.21
192_D	199_S	1.880	0.20
24_P	98_T	1.853	0.19
198_L	206_A	1.805	0.19
140_P	143_P	1.774	0.18
105_L	201_L	1.747	0.18
64_V	82_I	1.736	0.18
60_W	99_F	1.695	0.17
174_L	204_E	1.668	0.17
21_P	87_N	1.661	0.17
118_Y	194_I	1.645	0.17
21_P	48_A	1.644	0.17
182_A	198_L	1.629	0.17
106_K	118_Y	1.619	0.16
65_F	192_D	1.616	0.16
86_G	112_G	1.574	0.16
140_P	145_P	1.565	0.16
40_V	166_Q	1.539	0.15
118_Y	207_K	1.534	0.15
26_L	39_V	1.504	0.15
60_W	87_N	1.498	0.15
18_T	29_D	1.489	0.15
20_L	54_N	1.488	0.15
188_L	204_E	1.487	0.15
52_P	173_D	1.474	0.15
171_S	177_M	1.471	0.15
125_H	157_S	1.460	0.15
169_A	194_I	1.450	0.14
12_V	180_L	1.437	0.14
84_L	98_T	1.437	0.14
155_I	202_K	1.419	0.14
24_P	55_F	1.407	0.14
33_D	44_A	1.384	0.14
78_A	118_Y	1.368	0.14
45_V	196_A	1.365	0.13
87_N	90_G	1.360	0.13
26_L	34_T	1.348	0.13
93_S	98_T	1.341	0.13
180_L	210_S	1.335	0.13
184_A	202_K	1.335	0.13
37_H	163_V	1.323	0.13
78_A	206_A	1.320	0.13
104_L	132_V	1.316	0.13
14_Y	87_N	1.298	0.13
145_P	155_I	1.295	0.13
137_E	182_A	1.290	0.13
114_A	173_D	1.281	0.13
53_L	181_S	1.280	0.13
34_T	211_R	1.277	0.13
186_Q	196_A	1.274	0.13
91_P	160_M	1.263	0.12
115_S	199_S	1.261	0.12
60_W	93_S	1.248	0.12
15_L	105_L	1.247	0.12
49_V	118_Y	1.235	0.12
35_V	102_E	1.234	0.12
57_A	84_L	1.231	0.12
68_G	84_L	1.230	0.12
78_A	194_I	1.217	0.12
175_A	197_A	1.216	0.12
53_L	180_L	1.210	0.12
60_W	90_G	1.205	0.12
78_A	105_L	1.198	0.12
161_Y	188_L	1.198	0.12
97_I	185_R	1.193	0.12
44_A	179_T	1.187	0.12
48_A	71_P	1.187	0.12
124_W	187_Q	1.186	0.12
15_L	182_A	1.179	0.12
64_V	177_M	1.176	0.12
48_A	95_S	1.171	0.12
188_L	205_I	1.166	0.12
163_V	190_S	1.166	0.12
68_G	104_L	1.161	0.11
72_R	120_S	1.141	0.11
177_M	194_I	1.131	0.11
184_A	198_L	1.131	0.11
166_Q	201_L	1.122	0.11
92_Q	114_A	1.109	0.11
16_V	202_K	1.105	0.11
201_L	208_L	1.089	0.11
161_Y	166_Q	1.082	0.11
90_G	172_G	1.069	0.11
23_A	124_W	1.067	0.11
51_P	174_L	1.056	0.11
171_S	204_E	1.054	0.11
117_R	137_E	1.050	0.11
195_A	199_S	1.044	0.10
7_V	136_P	1.035	0.10
62_S	72_R	1.027	0.10
170_A	173_D	1.022	0.10
191_R	195_A	1.017	0.10
79_I	176_H	1.015	0.10
133_K	137_E	1.014	0.10
174_L	178_R	1.013	0.10
40_V	43_A	1.003	0.10
187_Q	208_L	0.997	0.10
11_P	121_N	0.992	0.10
171_S	174_L	0.980	0.10
174_L	188_L	0.973	0.10
174_L	205_I	0.968	0.10
33_D	166_Q	0.964	0.10
38_S	185_R	0.962	0.10
8_G	59_V	0.958	0.10
159_A	207_K	0.956	0.10
82_I	85_Q	0.952	0.10
72_R	180_L	0.946	0.10
177_M	184_A	0.945	0.10
85_Q	100_Y	0.941	0.10
86_G	99_F	0.939	0.10
99_F	112_G	0.939	0.10
171_S	186_Q	0.933	0.10
130_V	179_T	0.925	0.10
71_P	85_Q	0.922	0.09
97_I	115_S	0.920	0.09
60_W	197_A	0.912	0.09
106_K	197_A	0.909	0.09
68_G	134_A	0.907	0.09
45_V	194_I	0.904	0.09
130_V	133_K	0.902	0.09
95_S	129_N	0.900	0.09
63_Y	200_E	0.895	0.09
97_I	165_I	0.894	0.09
26_L	32_V	0.893	0.09
21_P	58_D	0.887	0.09
7_V	18_T	0.881	0.09
25_Q	203_A	0.878	0.09
198_L	202_K	0.871	0.09
35_V	87_N	0.863	0.09
24_P	82_I	0.862	0.09
12_V	210_S	0.861	0.09
120_S	192_D	0.854	0.09
163_V	206_A	0.852	0.09
159_A	162_G	0.849	0.09
93_S	138_L	0.846	0.09
64_V	67_L	0.844	0.09
101_G	203_A	0.844	0.09
81_Q	89_G	0.837	0.09
89_G	95_S	0.837	0.09
17_G	33_D	0.837	0.09
21_P	130_V	0.835	0.09
15_L	62_S	0.834	0.09
51_P	116_Y	0.822	0.09
35_V	58_D	0.820	0.09
43_A	117_R	0.815	0.09
67_L	121_N	0.813	0.09
93_S	96_M	0.813	0.09
14_Y	65_F	0.812	0.09
67_L	79_I	0.812	0.09
47_Q	124_W	0.810	0.09
52_P	116_Y	0.804	0.09
46_S	53_L	0.797	0.09
24_P	83_S	0.795	0.09
121_N	134_A	0.795	0.09
11_P	135_D	0.793	0.09
38_S	130_V	0.789	0.09
168_A	172_G	0.783	0.08
89_G	131_P	0.778	0.08
64_V	200_E	0.778	0.08
65_F	170_A	0.768	0.08
72_R	138_L	0.763	0.08
109_G	160_M	0.759	0.08
65_F	199_S	0.759	0.08
18_T	184_A	0.754	0.08
12_V	105_L	0.748	0.08
64_V	84_L	0.745	0.08
26_L	116_Y	0.745	0.08
31_M	121_N	0.744	0.08
52_P	70_P	0.742	0.08
32_V	105_L	0.739	0.08
103_L	165_I	0.738	0.08
71_P	94_N	0.726	0.08
161_Y	187_Q	0.720	0.08
159_A	183_Y	0.719	0.08
20_L	46_S	0.717	0.08
117_R	201_L	0.717	0.08
45_V	182_A	0.716	0.08
89_G	94_N	0.715	0.08
166_Q	188_L	0.709	0.08
84_L	125_H	0.708	0.08
161_Y	201_L	0.706	0.08
140_P	144_G	0.701	0.08
161_Y	171_S	0.698	0.08
16_V	163_V	0.692	0.08
60_W	91_P	0.688	0.08
29_D	132_V	0.687	0.08
114_A	199_S	0.685	0.08
111_T	210_S	0.682	0.08
18_T	115_S	0.680	0.08
18_T	173_D	0.671	0.08
82_I	185_R	0.666	0.08
54_N	193_E	0.666	0.08
168_A	187_Q	0.664	0.08
89_G	103_L	0.661	0.08
7_V	181_S	0.652	0.08
36_D	71_P	0.647	0.08
56_H	146_V	0.645	0.08
24_P	38_S	0.641	0.08
171_S	205_I	0.638	0.08
49_V	64_V	0.637	0.07
64_V	160_M	0.632	0.07
155_I	184_A	0.630	0.07
54_N	136_P	0.630	0.07
89_G	104_L	0.630	0.07
17_G	47_Q	0.629	0.07
10_F	61_G	0.625	0.07
10_F	41_G	0.625	0.07
10_F	28_L	0.625	0.07
10_F	22_G	0.625	0.07
9_L	61_G	0.625	0.07
28_L	61_G	0.625	0.07
28_L	41_G	0.625	0.07
22_G	61_G	0.625	0.07
9_L	41_G	0.625	0.07
41_G	61_G	0.625	0.07
9_L	28_L	0.625	0.07
9_L	22_G	0.625	0.07
22_G	28_L	0.625	0.07
22_G	41_G	0.625	0.07
190_S	197_A	0.619	0.07
106_K	184_A	0.619	0.07
48_A	97_I	0.616	0.07
114_A	180_L	0.616	0.07
84_L	100_Y	0.610	0.07
168_A	173_D	0.609	0.07
186_Q	204_E	0.608	0.07
174_L	209_E	0.606	0.07
7_V	62_S	0.606	0.07
50_S	180_L	0.606	0.07
50_S	83_S	0.604	0.07
39_V	108_D	0.603	0.07
171_S	200_E	0.596	0.07
19_G	190_S	0.592	0.07
78_A	197_A	0.590	0.07
6_R	194_I	0.589	0.07
174_L	186_Q	0.584	0.07
37_H	88_Q	0.584	0.07
53_L	126_E	0.579	0.07
132_V	175_A	0.576	0.07
60_W	98_T	0.573	0.07
64_V	117_R	0.572	0.07
39_V	203_A	0.565	0.07
50_S	193_E	0.565	0.07
56_H	170_A	0.561	0.07
27_V	105_L	0.560	0.07
176_H	195_A	0.556	0.07
162_G	176_H	0.554	0.07
12_V	133_K	0.550	0.07
89_G	129_N	0.548	0.07
138_L	176_H	0.546	0.07
53_L	114_A	0.545	0.07
6_R	192_D	0.545	0.07
69_P	78_A	0.545	0.07
14_Y	58_D	0.544	0.07
38_S	49_V	0.544	0.07
34_T	127_V	0.544	0.07
176_H	179_T	0.543	0.07
11_P	131_P	0.539	0.07
49_V	126_E	0.538	0.07
104_L	156_G	0.536	0.07
177_M	188_L	0.535	0.07
18_T	194_I	0.529	0.07
72_R	143_P	0.528	0.07
115_S	192_D	0.528	0.07
78_A	163_V	0.523	0.07
46_S	72_R	0.521	0.07
82_I	103_L	0.520	0.07
113_V	189_E	0.516	0.07
21_P	191_R	0.514	0.07
70_P	128_E	0.512	0.07
73_R	105_L	0.510	0.07
107_G	203_A	0.506	0.07
72_R	142_E	0.504	0.07
116_Y	178_R	0.501	0.07
122_G	156_G	0.501	0.07
85_Q	113_V	0.500	0.07
24_P	133_K	0.500	0.07
57_A	98_T	0.500	0.07

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qpr_A	1	0	43	0.963	Contact Map
4jkv_A	1	0.2972	38.4	0.964	Contact Map
1r48_A	1	0.1132	31.5	0.966	Contact Map
4b86_A	1	0.1698	26.6	0.967	Contact Map
4e61_A	1	0.1934	23.5	0.968	Contact Map
2a26_A	1	0.2264	23	0.968	Contact Map
2b0t_A	1	0.4434	17.2	0.97	Contact Map
4l8j_A	1	0.5849	16.5	0.97	Contact Map
3pqa_A	1	0.3538	15.5	0.97	Contact Map
1ysm_A	1	0.2311	15.5	0.97	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.