T0870_1_138 - CASP12 - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

T0870_1_138 - T0870 1-138

ID:	10	Sequences: MITLRKLIGNINMTKEPEQQSPLELWFERIIDVPLEKLTVEDLCRAIRQNLCIDQLMPRVLEVLTKEPLAGEYYDGELIAALSTIKGEDLKDQKSTFTQIRQLINQLEPSDINDDLRKDILKINQIIVTSLEHHHHHH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	138 (112)
Sequences:	66 (54)
Seq/√Len:	5.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_L	46_A	3.995	0.90
23_L	74_Y	2.874	0.68
38_L	52_C	2.535	0.58
69_L	76_G	2.429	0.54
46_A	52_C	2.324	0.51
60_V	79_I	2.006	0.40
17_P	83_S	1.993	0.40
68_P	76_G	1.935	0.38
41_E	44_C	1.927	0.38
13_M	31_I	1.900	0.37
67_E	76_G	1.880	0.37
45_R	50_N	1.879	0.36
42_D	68_P	1.878	0.36
34_P	58_P	1.872	0.36
13_M	28_E	1.830	0.35
70_A	74_Y	1.731	0.32
53_I	107_L	1.700	0.31
74_Y	78_L	1.686	0.31
26_W	40_V	1.654	0.30
42_D	76_G	1.571	0.28
22_P	45_R	1.549	0.27
30_I	33_V	1.542	0.27
7_L	56_L	1.535	0.27
35_L	91_K	1.529	0.27
45_R	75_D	1.507	0.26
31_I	115_D	1.489	0.26
8_I	100_I	1.438	0.24
71_G	74_Y	1.422	0.24
43_L	47_I	1.415	0.24
10_N	53_I	1.413	0.24
5_R	46_A	1.377	0.23
30_I	42_D	1.366	0.23
29_R	61_L	1.352	0.22
24_E	57_M	1.337	0.22
64_L	78_L	1.333	0.22
51_L	62_E	1.312	0.21
51_L	54_D	1.293	0.21
57_M	60_V	1.280	0.21
95_S	101_R	1.258	0.20
6_K	61_L	1.249	0.20
20_Q	51_L	1.206	0.19
35_L	58_P	1.187	0.19
38_L	45_R	1.185	0.19
30_I	59_R	1.138	0.18
30_I	79_I	1.133	0.18
68_P	111_D	1.106	0.17
30_I	60_V	1.101	0.17
34_P	83_S	1.072	0.17
49_Q	76_G	1.068	0.17
7_L	52_C	1.062	0.16
70_A	106_Q	1.059	0.16
23_L	78_L	1.053	0.16
39_T	89_D	1.046	0.16
34_P	43_L	1.036	0.16
11_I	24_E	1.021	0.16
83_S	115_D	1.020	0.16
18_E	100_I	1.009	0.16
66_K	72_E	1.008	0.16
49_Q	78_L	0.999	0.15
24_E	53_I	0.998	0.15
6_K	43_L	0.990	0.15
10_N	95_S	0.979	0.15
83_S	113_N	0.956	0.15
24_E	77_E	0.953	0.15
57_M	97_F	0.944	0.14
6_K	59_R	0.934	0.14
47_I	71_G	0.922	0.14
37_K	88_E	0.918	0.14
31_I	81_A	0.917	0.14
49_Q	64_L	0.908	0.14
86_K	99_Q	0.894	0.14
13_M	32_D	0.888	0.14
64_L	76_G	0.882	0.13
25_L	102_Q	0.876	0.13
29_R	62_E	0.868	0.13
57_M	111_D	0.867	0.13
37_K	104_I	0.865	0.13
31_I	90_L	0.861	0.13
47_I	53_I	0.847	0.13
60_V	64_L	0.837	0.13
9_G	104_I	0.832	0.13
62_E	102_Q	0.831	0.13
63_V	70_A	0.826	0.13
88_E	102_Q	0.823	0.13
47_I	74_Y	0.802	0.12
44_C	77_E	0.801	0.12
8_I	60_V	0.799	0.12
93_Q	104_I	0.795	0.12
50_N	102_Q	0.792	0.12
12_N	94_K	0.792	0.12
66_K	106_Q	0.788	0.12
40_V	91_K	0.784	0.12
26_W	48_R	0.780	0.12
59_R	89_D	0.780	0.12
82_L	85_I	0.777	0.12
61_L	70_A	0.776	0.12
11_I	81_A	0.773	0.12
7_L	73_Y	0.770	0.12
42_D	47_I	0.752	0.12
41_E	66_K	0.751	0.12
75_D	88_E	0.749	0.12
65_T	84_T	0.743	0.11
12_N	61_L	0.733	0.11
47_I	78_L	0.730	0.11
33_V	39_T	0.728	0.11
22_P	38_L	0.727	0.11
8_I	103_L	0.724	0.11
63_V	85_I	0.721	0.11
40_V	54_D	0.721	0.11
5_R	15_K	0.720	0.11
77_E	90_L	0.717	0.11
25_L	38_L	0.717	0.11
20_Q	100_I	0.713	0.11
26_W	45_R	0.708	0.11
33_V	97_F	0.702	0.11
85_I	108_E	0.702	0.11
18_E	88_E	0.701	0.11
48_R	91_K	0.699	0.11
25_L	86_K	0.692	0.11
56_L	73_Y	0.689	0.11
73_Y	81_A	0.686	0.11
23_L	35_L	0.683	0.11
18_E	108_E	0.681	0.11
20_Q	43_L	0.670	0.11
30_I	46_A	0.670	0.11
35_L	95_S	0.667	0.11
41_E	45_R	0.661	0.10
41_E	56_L	0.657	0.10
28_E	31_I	0.657	0.10
22_P	46_A	0.650	0.10
44_C	75_D	0.650	0.10
25_L	85_I	0.649	0.10
75_D	86_K	0.649	0.10
43_L	68_P	0.648	0.10
40_V	43_L	0.644	0.10
58_P	96_T	0.644	0.10
57_M	61_L	0.638	0.10
23_L	104_I	0.638	0.10
71_G	78_L	0.637	0.10
96_T	99_Q	0.628	0.10
54_D	94_K	0.621	0.10
39_T	44_C	0.615	0.10
34_P	47_I	0.605	0.10
77_E	89_D	0.603	0.10
8_I	37_K	0.598	0.10
24_E	110_S	0.593	0.10
49_Q	60_V	0.588	0.10
53_I	77_E	0.588	0.10
47_I	56_L	0.578	0.09
10_N	44_C	0.571	0.09
18_E	33_V	0.566	0.09
40_V	70_A	0.565	0.09
10_N	96_T	0.562	0.09
88_E	106_Q	0.557	0.09
60_V	77_E	0.542	0.09
45_R	82_L	0.540	0.09
5_R	37_K	0.534	0.09
25_L	51_L	0.531	0.09
51_L	87_G	0.529	0.09
35_L	96_T	0.526	0.09
57_M	79_I	0.523	0.09
47_I	105_N	0.522	0.09
13_M	81_A	0.522	0.09
50_N	104_I	0.516	0.09
67_E	92_D	0.511	0.09
18_E	54_D	0.507	0.09
23_L	49_Q	0.505	0.09
16_E	19_Q	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g5h_A	1	0.4348	24.6	0.929	Contact Map
4j2o_A	1	0.2681	13.9	0.936	Contact Map
3ffv_A	1	0.7971	13	0.937	Contact Map
4hdh_A	1	0.4203	9.7	0.941	Contact Map
3bs7_A	1	0.5	9.3	0.941	Contact Map
2gle_A	1	0.5072	8.2	0.942	Contact Map
4ov4_A	1	0.3406	8	0.943	Contact Map
1t98_A	1	0.6812	7.6	0.943	Contact Map
1pn5_A	1	0.6014	7	0.945	Contact Map
4xqk_A	1	0.9348	6.7	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.