YLZA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLZA - UPF0296 protein YlzA

UniProt:	Q7WY72	Sequences: MTIKLINIGFGNIISANRMISIVSPESAPIKRMIQDARDRGMLIDATYGRRTRAVVVMDSDHIILSAVQPETVAHRLSVKEEIMDEGQG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	89 (80)
Sequences:	409 (234)
Seq/√Len:	26.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_R	59_D	5.477	1.00
25_P	54_A	2.796	1.00
30_I	55_V	2.646	0.99
18_R	62_H	2.211	0.98
42_M	61_D	1.993	0.95
19_M	56_V	1.823	0.93
36_D	43_L	1.796	0.92
18_R	36_D	1.765	0.91
72_T	76_R	1.706	0.90
18_R	60_S	1.655	0.88
26_E	35_Q	1.537	0.84
53_R	72_T	1.523	0.84
19_M	77_L	1.521	0.84
23_V	30_I	1.510	0.83
61_D	77_L	1.502	0.83
39_D	58_M	1.492	0.83
69_Q	72_T	1.472	0.82
12_N	49_G	1.411	0.79
35_Q	55_V	1.365	0.76
38_R	45_D	1.355	0.76
58_M	61_D	1.341	0.75
15_S	67_A	1.341	0.75
31_K	46_A	1.338	0.75
14_I	66_S	1.309	0.73
43_L	63_I	1.231	0.69
6_I	77_L	1.212	0.67
27_S	48_Y	1.211	0.67
53_R	69_Q	1.200	0.67
27_S	53_R	1.195	0.66
20_I	40_R	1.184	0.66
37_A	69_Q	1.163	0.64
16_A	63_I	1.157	0.64
29_P	49_G	1.149	0.63
13_I	61_D	1.148	0.63
10_F	68_V	1.138	0.62
14_I	44_I	1.102	0.60
33_M	38_R	1.081	0.58
34_I	55_V	1.075	0.58
5_L	21_S	1.066	0.57
20_I	58_M	1.064	0.57
26_E	30_I	1.047	0.56
24_S	55_V	1.041	0.55
12_N	44_I	1.011	0.53
57_V	60_S	1.008	0.53
3_I	17_N	0.987	0.51
50_R	70_P	0.987	0.51
5_L	77_L	0.985	0.51
7_N	46_A	0.974	0.50
25_P	30_I	0.943	0.48
26_E	73_V	0.941	0.48
22_I	54_A	0.935	0.48
19_M	59_D	0.928	0.47
39_D	43_L	0.893	0.44
56_V	77_L	0.891	0.44
37_A	63_I	0.885	0.44
13_I	68_V	0.874	0.43
27_S	75_H	0.873	0.43
50_R	65_L	0.873	0.43
34_I	54_A	0.860	0.42
30_I	78_S	0.832	0.40
19_M	80_K	0.825	0.40
32_R	46_A	0.818	0.39
19_M	47_T	0.798	0.38
17_N	40_R	0.796	0.38
27_S	62_H	0.794	0.37
67_A	70_P	0.782	0.37
47_T	77_L	0.781	0.36
7_N	65_L	0.780	0.36
17_N	81_E	0.778	0.36
7_N	11_G	0.777	0.36
37_A	53_R	0.776	0.36
23_V	61_D	0.770	0.36
44_I	60_S	0.750	0.34
58_M	64_I	0.746	0.34
50_R	71_E	0.744	0.34
48_Y	77_L	0.734	0.33
63_I	78_S	0.733	0.33
17_N	51_R	0.718	0.32
15_S	40_R	0.715	0.32
26_E	39_D	0.712	0.32
23_V	46_A	0.711	0.32
43_L	71_E	0.700	0.31
59_D	62_H	0.695	0.31
19_M	79_V	0.694	0.31
33_M	67_A	0.693	0.31
9_G	12_N	0.687	0.30
13_I	41_G	0.684	0.30
28_A	31_K	0.664	0.29
26_E	48_Y	0.658	0.29
57_V	64_I	0.655	0.28
20_I	42_M	0.634	0.27
8_I	25_P	0.611	0.26
64_I	80_K	0.607	0.26
18_R	63_I	0.600	0.25
4_K	21_S	0.596	0.25
10_F	51_R	0.592	0.25
13_I	82_E	0.588	0.24
19_M	82_E	0.587	0.24
17_N	78_S	0.584	0.24
35_Q	43_L	0.579	0.24
4_K	28_A	0.564	0.23
33_M	40_R	0.563	0.23
33_M	61_D	0.562	0.23
33_M	82_E	0.561	0.23
46_A	66_S	0.560	0.23
45_D	65_L	0.555	0.23
70_P	76_R	0.553	0.23
53_R	57_V	0.551	0.22
34_I	44_I	0.549	0.22
33_M	44_I	0.546	0.22
51_R	75_H	0.542	0.22
13_I	20_I	0.539	0.22
17_N	34_I	0.536	0.22
5_L	15_S	0.535	0.22
42_M	56_V	0.532	0.22
31_K	48_Y	0.524	0.21
70_P	74_A	0.524	0.21
19_M	72_T	0.516	0.21
39_D	70_P	0.514	0.21
4_K	79_V	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pjsK	4	0.8764	23.9	0.926	Contact Map
2etxA	2	0.3483	11.1	0.936	Contact Map
4r3oC	1	0.9888	10	0.938	Contact Map
1rypL	1	1	10	0.938	Contact Map
4nr2A	2	0.3483	8.9	0.939	Contact Map
2werA	2	0.9101	6	0.944	Contact Map
4l0nA	2	0.3483	5.8	0.944	Contact Map
1m4lA	1	0.4494	5.8	0.944	Contact Map
2k1eA	3	0.4494	5.3	0.945	Contact Map
4r3oD	1	0.9551	5.2	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.