MRPE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MRPE - Na(+)/H(+) antiporter subunit E

UniProt:	Q7WY60	Sequences: MAFQILLNVFLAFCWMFLSNSPSAAGFITGYILGMLSLFFFRRFFTRQFYLWKLISIIKLCFIFIKELYLANVSVMKSVLSPKLNIRPGIFAFKTELTKDWEITMLSLLITLTPGTLVMDISDDRTILYIHAMDIEDAEKAIFDIRESFEKAIQEVSR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	158 (153)
Sequences:	1916 (1478)
Seq/√Len:	119.4

BACSU - MRPE
HALSA - Q9HRS2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_L	109_L	5.112	1.00
12_A	34_G	4.302	1.00
96_E	146_R	3.748	1.00
74_S	78_S	3.153	1.00
139_E	143_F	2.836	1.00
92_A	127_I	2.821	1.00
89_G	135_I	2.657	1.00
66_K	70_L	2.544	1.00
77_K	81_S	2.310	1.00
143_F	147_E	2.253	1.00
81_S	85_N	2.216	1.00
92_A	129_Y	2.209	1.00
64_F	68_L	2.043	1.00
93_F	130_I	1.979	1.00
62_F	66_K	1.957	1.00
16_M	27_F	1.908	1.00
64_F	109_L	1.903	1.00
96_E	154_Q	1.867	1.00
106_L	145_I	1.861	1.00
98_T	126_T	1.816	1.00
78_S	133_M	1.802	1.00
67_E	70_L	1.801	1.00
58_I	62_F	1.784	1.00
99_K	102_E	1.754	1.00
8_N	12_A	1.700	1.00
132_A	135_I	1.637	1.00
75_V	133_M	1.593	1.00
137_D	140_K	1.587	1.00
97_L	102_E	1.580	1.00
25_A	29_T	1.574	1.00
22_P	27_F	1.574	1.00
8_N	38_L	1.555	1.00
59_K	152_A	1.539	1.00
56_S	59_K	1.517	1.00
142_I	145_I	1.487	1.00
107_S	118_V	1.487	1.00
55_I	59_K	1.465	1.00
12_A	31_Y	1.455	1.00
19_S	26_G	1.410	1.00
77_K	80_L	1.401	1.00
12_A	27_F	1.378	1.00
8_N	31_Y	1.366	1.00
93_F	146_R	1.362	1.00
23_S	26_G	1.348	1.00
81_S	84_L	1.341	1.00
90_I	129_Y	1.329	1.00
78_S	134_D	1.329	1.00
97_L	106_L	1.321	1.00
91_F	132_A	1.315	1.00
138_A	142_I	1.305	1.00
107_S	111_T	1.264	0.99
76_M	79_V	1.240	0.99
87_R	136_E	1.222	0.99
110_I	113_T	1.202	0.99
60_L	64_F	1.180	0.99
73_V	77_K	1.180	0.99
12_A	30_G	1.172	0.99
87_R	134_D	1.170	0.99
74_S	77_K	1.169	0.99
82_P	85_N	1.159	0.99
148_S	152_A	1.148	0.99
118_V	128_L	1.147	0.99
64_F	104_T	1.083	0.98
76_M	80_L	1.081	0.98
147_E	151_K	1.070	0.98
15_W	30_G	1.064	0.98
56_S	152_A	1.061	0.98
26_G	29_T	1.053	0.98
67_E	149_F	1.041	0.98
110_I	116_T	1.032	0.98
109_L	153_I	1.025	0.98
139_E	142_I	1.012	0.98
70_L	74_S	1.005	0.97
142_I	146_R	0.996	0.97
111_T	118_V	0.985	0.97
106_L	153_I	0.984	0.97
59_K	63_I	0.974	0.97
8_N	34_G	0.962	0.97
108_L	113_T	0.959	0.97
35_M	38_L	0.943	0.96
59_K	155_E	0.933	0.96
13_F	22_P	0.930	0.96
122_S	125_R	0.928	0.96
108_L	130_I	0.916	0.96
67_E	148_S	0.910	0.95
151_K	155_E	0.909	0.95
68_L	109_L	0.907	0.95
64_F	112_L	0.903	0.95
110_I	118_V	0.902	0.95
31_Y	35_M	0.885	0.95
61_C	65_I	0.885	0.95
53_K	56_S	0.876	0.94
57_I	96_E	0.873	0.94
95_T	103_I	0.864	0.94
16_M	22_P	0.852	0.93
69_Y	73_V	0.852	0.93
60_L	156_V	0.849	0.93
30_G	33_L	0.844	0.93
94_K	142_I	0.839	0.93
12_A	38_L	0.836	0.93
111_T	116_T	0.833	0.93
90_I	119_M	0.827	0.92
56_S	155_E	0.825	0.92
120_D	129_Y	0.820	0.92
36_L	40_F	0.817	0.92
149_F	153_I	0.813	0.92
146_R	150_E	0.812	0.92
12_A	16_M	0.806	0.91
63_I	66_K	0.805	0.91
93_F	106_L	0.804	0.91
31_Y	50_Y	0.802	0.91
97_L	154_Q	0.792	0.91
122_S	126_T	0.789	0.91
103_I	124_D	0.785	0.90
93_F	110_I	0.782	0.90
108_L	118_V	0.779	0.90
108_L	112_L	0.774	0.90
140_K	144_D	0.773	0.90
11_L	30_G	0.767	0.89
34_G	147_E	0.760	0.89
72_N	76_M	0.758	0.89
98_T	103_I	0.750	0.88
71_A	74_S	0.746	0.88
29_T	33_L	0.742	0.88
55_I	58_I	0.740	0.88
14_C	18_L	0.739	0.87
103_I	121_I	0.736	0.87
33_L	36_L	0.732	0.87
149_F	155_E	0.732	0.87
65_I	69_Y	0.730	0.87
27_F	50_Y	0.726	0.87
59_K	62_F	0.725	0.86
132_A	141_A	0.723	0.86
30_G	38_L	0.722	0.86
19_S	22_P	0.718	0.86
68_L	112_L	0.718	0.86
141_A	144_D	0.718	0.86
103_I	128_L	0.714	0.86
27_F	31_Y	0.711	0.85
63_I	152_A	0.711	0.85
11_L	15_W	0.710	0.85
77_K	85_N	0.702	0.85
94_K	125_R	0.695	0.84
96_E	150_E	0.694	0.84
77_K	134_D	0.682	0.83
67_E	113_T	0.673	0.82
88_P	113_T	0.672	0.82
34_G	38_L	0.672	0.82
29_T	32_I	0.671	0.82
69_Y	72_N	0.670	0.82
89_G	92_A	0.667	0.82
92_A	125_R	0.666	0.81
21_S	26_G	0.665	0.81
54_L	58_I	0.665	0.81
86_I	134_D	0.663	0.81
61_C	84_L	0.643	0.79
10_F	14_C	0.641	0.79
52_W	57_I	0.640	0.79
78_S	85_N	0.639	0.79
31_Y	62_F	0.638	0.79
113_T	130_I	0.637	0.78
143_F	146_R	0.635	0.78
32_I	36_L	0.635	0.78
21_S	105_M	0.633	0.78
113_T	116_T	0.631	0.78
118_V	121_I	0.624	0.77
101_W	104_T	0.620	0.77
113_T	121_I	0.617	0.76
107_S	128_L	0.617	0.76
110_I	145_I	0.610	0.75
41_F	45_F	0.604	0.75
31_Y	34_G	0.602	0.75
62_F	65_I	0.600	0.74
79_V	113_T	0.599	0.74
82_P	131_H	0.598	0.74
36_L	147_E	0.596	0.74
8_N	35_M	0.594	0.74
28_I	137_D	0.592	0.73
68_L	129_Y	0.588	0.73
68_L	79_V	0.587	0.73
93_F	128_L	0.585	0.72
110_I	130_I	0.582	0.72
148_S	151_K	0.577	0.71
74_S	133_M	0.577	0.71
153_I	156_V	0.573	0.71
82_P	88_P	0.571	0.71
108_L	116_T	0.571	0.71
21_S	27_F	0.570	0.70
8_N	50_Y	0.568	0.70
59_K	66_K	0.566	0.70
6_L	11_L	0.566	0.70
71_A	148_S	0.565	0.70
95_T	106_L	0.563	0.70
5_I	31_Y	0.559	0.69
137_D	146_R	0.553	0.68
22_P	144_D	0.553	0.68
71_A	113_T	0.552	0.68
63_I	67_E	0.551	0.68
39_F	42_R	0.551	0.68
36_L	39_F	0.548	0.67
20_N	157_S	0.547	0.67
71_A	108_L	0.546	0.67
18_L	120_D	0.541	0.67
16_M	19_S	0.541	0.67
66_K	69_Y	0.540	0.66
16_M	21_S	0.538	0.66
135_I	138_A	0.536	0.66
52_W	105_M	0.534	0.66
31_Y	66_K	0.533	0.65
60_L	71_A	0.532	0.65
71_A	143_F	0.531	0.65
41_F	44_F	0.531	0.65
79_V	84_L	0.528	0.65
112_L	141_A	0.527	0.65
15_W	26_G	0.526	0.64
16_M	26_G	0.526	0.64
20_N	61_C	0.522	0.64
91_F	141_A	0.518	0.63
9_V	25_A	0.517	0.63
98_T	102_E	0.516	0.63
49_F	95_T	0.513	0.62
65_I	139_E	0.509	0.62
40_F	48_Q	0.509	0.62
109_L	154_Q	0.508	0.62
63_I	97_L	0.506	0.61
28_I	45_F	0.505	0.61
140_K	143_F	0.505	0.61
95_T	107_S	0.505	0.61
47_R	143_F	0.502	0.61
60_L	110_I	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ookA	2	0.3038	11.3	0.94	Contact Map
4wxaA	1	0.4557	6	0.947	Contact Map
2rq6A	1	0.538	5.6	0.948	Contact Map
2werA	2	0.5063	4.5	0.95	Contact Map
4wnyA	2	0.4114	4	0.951	Contact Map
1ghhA	1	0.2152	4	0.951	Contact Map
4q4fA	1	0.3354	4	0.951	Contact Map
1vi7A	1	0.3228	2.7	0.955	Contact Map
2qe7H	1	0.5	2.3	0.957	Contact Map
4q2lA	1	0.3924	2.2	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.