SPSL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SPSL - Spore coat polysaccharide biosynthesis protein SpsL

UniProt:	Q7WY56	Sequences: MIDGVKVKKLMKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDDLWFFPTGHAQVVLYDLREDSKTKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYFTTMSYNPDQPDEKRIPWDDETIGFNWNTEFR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (143)
Sequences:	4233 (2574)
Seq/√Len:	215.2

ECOLI - RMLC
BACSU - SPSL
SULSO - Q97X30 Q7LXE5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_D	33_H	3.416	1.00
66_H	88_Y	3.347	1.00
111_G	115_L	2.992	1.00
9_K	95_M	2.802	1.00
126_N	131_D	2.753	1.00
54_E	133_K	2.676	1.00
67_A	117_I	2.674	1.00
47_I	108_R	2.428	1.00
50_F	104_A	2.408	1.00
57_D	98_L	2.379	1.00
68_Q	86_V	2.335	1.00
37_A	120_F	2.331	1.00
40_S	107_Y	2.299	1.00
27_D	124_S	2.257	1.00
57_D	122_T	2.133	1.00
64_T	91_E	2.081	1.00
44_P	113_T	2.065	1.00
101_K	122_T	1.990	1.00
63_P	118_I	1.976	1.00
64_T	116_T	1.914	1.00
64_T	114_P	1.910	1.00
7_V	95_M	1.905	1.00
41_K	116_T	1.838	1.00
39_W	116_T	1.797	1.00
52_Y	133_K	1.755	1.00
66_H	111_G	1.755	1.00
90_G	93_N	1.699	1.00
74_L	104_A	1.685	1.00
57_D	101_K	1.684	1.00
68_Q	147_N	1.678	1.00
5_V	71_L	1.678	1.00
39_W	61_F	1.629	1.00
7_V	87_Y	1.629	1.00
66_H	90_G	1.602	1.00
50_F	106_G	1.558	1.00
5_V	85_D	1.493	1.00
12_K	94_P	1.473	1.00
25_R	28_E	1.468	1.00
32_E	98_L	1.443	1.00
19_F	41_K	1.398	1.00
67_A	115_L	1.382	1.00
109_V	115_L	1.362	1.00
108_R	148_T	1.336	1.00
128_D	131_D	1.323	1.00
135_I	142_I	1.277	1.00
71_L	85_D	1.277	1.00
101_K	123_M	1.252	1.00
100_P	103_V	1.240	1.00
32_E	101_K	1.234	1.00
22_E	25_R	1.227	1.00
55_K	131_D	1.189	1.00
70_V	146_W	1.179	1.00
104_A	135_I	1.157	1.00
87_Y	97_L	1.135	1.00
52_Y	104_A	1.132	1.00
111_G	114_P	1.095	1.00
108_R	147_N	1.090	1.00
50_F	72_Y	1.089	1.00
25_R	124_S	1.083	1.00
69_V	105_H	1.078	1.00
20_F	40_S	1.073	1.00
41_K	114_P	1.072	1.00
54_E	131_D	1.069	1.00
44_P	111_G	1.047	1.00
39_W	118_I	1.038	1.00
87_Y	95_M	1.026	1.00
38_S	121_T	1.004	1.00
82_G	141_T	1.004	1.00
19_F	39_W	0.997	1.00
22_E	36_Q	0.989	1.00
75_R	103_V	0.985	1.00
23_L	37_A	0.980	1.00
52_Y	74_L	0.966	1.00
22_E	56_Q	0.964	1.00
8_K	28_E	0.958	1.00
11_M	28_E	0.953	1.00
35_G	124_S	0.945	1.00
71_L	103_V	0.936	0.99
50_F	144_F	0.927	0.99
74_L	135_I	0.925	0.99
19_F	94_P	0.924	0.99
4_G	80_T	0.916	0.99
68_Q	84_T	0.912	0.99
89_M	97_L	0.904	0.99
63_P	116_T	0.902	0.99
34_F	37_A	0.890	0.99
88_Y	110_L	0.885	0.99
19_F	116_T	0.885	0.99
70_V	144_F	0.876	0.99
109_V	114_P	0.873	0.99
84_T	142_I	0.864	0.99
7_V	97_L	0.843	0.99
5_V	97_L	0.837	0.99
3_D	79_K	0.831	0.99
71_L	99_I	0.823	0.99
7_V	85_D	0.814	0.99
30_L	101_K	0.812	0.99
12_K	21_A	0.804	0.98
3_D	80_T	0.804	0.98
20_F	38_S	0.803	0.98
39_W	63_P	0.801	0.98
43_Y	114_P	0.796	0.98
118_I	121_T	0.789	0.98
8_K	59_L	0.778	0.98
98_L	122_T	0.760	0.98
86_V	147_N	0.758	0.98
43_Y	113_T	0.758	0.98
110_L	147_N	0.755	0.98
80_T	83_E	0.752	0.98
62_F	115_L	0.748	0.98
34_F	122_T	0.747	0.97
55_K	126_N	0.743	0.97
30_L	98_L	0.738	0.97
71_L	97_L	0.732	0.97
23_L	39_W	0.725	0.97
7_V	93_N	0.722	0.97
26_D	31_L	0.720	0.97
14_S	94_P	0.719	0.97
66_H	115_L	0.717	0.97
58_D	69_V	0.716	0.97
32_E	122_T	0.711	0.97
62_F	67_A	0.705	0.96
52_Y	135_I	0.699	0.96
21_A	94_P	0.691	0.96
30_L	33_H	0.691	0.96
61_F	118_I	0.689	0.96
91_E	94_P	0.686	0.96
85_D	97_L	0.684	0.96
23_L	61_F	0.684	0.96
42_S	48_K	0.680	0.96
43_Y	46_V	0.679	0.96
22_E	38_S	0.676	0.96
94_P	116_T	0.672	0.95
50_F	142_I	0.669	0.95
42_S	46_V	0.667	0.95
12_K	19_F	0.662	0.95
47_I	146_W	0.660	0.95
23_L	118_I	0.652	0.95
125_Y	132_E	0.650	0.94
15_D	18_G	0.649	0.94
47_I	137_W	0.648	0.94
20_F	119_Y	0.638	0.94
68_Q	110_L	0.631	0.94
72_Y	104_A	0.630	0.93
76_E	79_K	0.627	0.93
11_M	14_S	0.623	0.93
56_Q	121_T	0.617	0.93
35_G	123_M	0.616	0.93
38_S	119_Y	0.616	0.93
50_F	135_I	0.614	0.93
3_D	6_K	0.612	0.92
34_F	120_F	0.611	0.92
41_K	64_T	0.609	0.92
67_A	107_Y	0.607	0.92
14_S	43_Y	0.607	0.92
70_V	86_V	0.604	0.92
123_M	131_D	0.603	0.92
90_G	94_P	0.597	0.92
91_E	116_T	0.596	0.91
23_L	120_F	0.595	0.91
60_W	117_I	0.595	0.91
9_K	93_N	0.594	0.91
66_H	110_L	0.591	0.91
6_K	100_P	0.590	0.91
59_L	98_L	0.589	0.91
142_I	145_N	0.587	0.91
61_F	116_T	0.587	0.91
72_Y	135_I	0.586	0.91
59_L	96_L	0.582	0.91
26_D	124_S	0.580	0.90
98_L	101_K	0.576	0.90
5_V	103_V	0.574	0.90
10_L	96_L	0.572	0.90
88_Y	147_N	0.571	0.90
88_Y	93_N	0.571	0.90
72_Y	142_I	0.570	0.90
91_E	111_G	0.566	0.89
85_D	88_Y	0.564	0.89
68_Q	88_Y	0.563	0.89
76_E	82_G	0.562	0.89
60_W	69_V	0.559	0.89
121_T	133_K	0.558	0.89
55_K	123_M	0.556	0.88
8_K	30_L	0.555	0.88
67_A	109_V	0.554	0.88
10_L	21_A	0.551	0.88
71_L	87_Y	0.549	0.88
73_D	80_T	0.545	0.87
68_Q	145_N	0.543	0.87
20_F	36_Q	0.542	0.87
105_H	132_E	0.542	0.87
6_K	29_N	0.542	0.87
56_Q	105_H	0.540	0.87
6_K	98_L	0.540	0.87
140_E	143_G	0.538	0.87
21_A	39_W	0.537	0.87
59_L	142_I	0.536	0.87
26_D	145_N	0.535	0.86
106_G	146_W	0.534	0.86
29_N	32_E	0.530	0.86
66_H	91_E	0.529	0.86
44_P	109_V	0.523	0.85
20_F	121_T	0.523	0.85
75_R	102_G	0.522	0.85
47_I	147_N	0.518	0.85
47_I	148_T	0.514	0.84
21_A	61_F	0.513	0.84
61_F	96_L	0.512	0.84
69_V	97_L	0.509	0.84
53_H	132_E	0.507	0.83
60_W	67_A	0.506	0.83
89_M	95_M	0.504	0.83
32_E	57_D	0.500	0.83
62_F	117_I	0.500	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hn1A	3	0.9801	100	0.146	Contact Map
2c0zA	2	0.9735	100	0.146	Contact Map
1upiA	2	0.9801	100	0.147	Contact Map
1oi6A	2	0.9801	100	0.15	Contact Map
2ixkA	2	0.9801	100	0.151	Contact Map
1dzrA	2	0.9801	100	0.155	Contact Map
3rykA	2	0.9801	100	0.156	Contact Map
1ep0A	2	0.9801	100	0.159	Contact Map
1nxmA	2	0.9536	100	0.2	Contact Map
5buvA	2	0.9669	100	0.21	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.