ACPK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ACPK - Polyketide biosynthesis acyl-carrier-protein AcpK

UniProt:	Q7PC63	Sequences: MDKQRIFEVLITNICEVLPELDGHRFEPEDQLVELGADSVDRAEIITMVLEDLSLKIPRIELSGVKNIGELAEVLYDKVQSA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	82 (69)
Sequences:	22925 (18583)
Seq/√Len:	2237.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_E	69_G	2.428	1.00
13_N	52_D	2.425	1.00
58_P	61_E	2.117	1.00
61_E	74_V	2.073	1.00
67_N	70_E	2.055	1.00
65_V	74_V	2.030	1.00
38_D	41_D	1.822	1.00
11_I	28_P	1.810	1.00
20_E	48_M	1.799	1.00
31_Q	66_K	1.778	1.00
32_L	37_A	1.700	1.00
13_N	16_E	1.680	1.00
18_L	37_A	1.604	1.00
50_L	56_K	1.533	1.00
27_E	30_D	1.500	1.00
65_V	70_E	1.435	1.00
31_Q	34_E	1.392	1.00
15_C	28_P	1.388	1.00
28_P	69_G	1.386	1.00
15_C	68_I	1.345	1.00
15_C	19_P	1.339	1.00
13_N	17_V	1.289	1.00
18_L	68_I	1.253	1.00
48_M	52_D	1.245	1.00
45_I	62_L	1.239	1.00
46_I	50_L	1.229	1.00
19_P	25_R	1.198	1.00
60_I	64_G	1.161	1.00
28_P	68_I	1.143	1.00
17_V	20_E	1.128	1.00
14_I	72_A	1.113	1.00
16_E	52_D	1.108	1.00
10_L	76_Y	1.108	1.00
41_D	44_E	1.098	1.00
9_V	13_N	1.083	1.00
14_I	68_I	1.080	1.00
42_R	62_L	1.061	1.00
17_V	48_M	1.056	1.00
42_R	46_I	1.052	1.00
44_E	48_M	1.040	1.00
18_L	71_L	1.020	1.00
18_L	45_I	1.008	1.00
11_I	72_A	0.991	1.00
9_V	12_T	0.961	1.00
17_V	45_I	0.958	1.00
14_I	49_V	0.947	1.00
21_L	48_M	0.944	1.00
15_C	26_F	0.943	1.00
10_L	13_N	0.937	1.00
12_T	16_E	0.921	1.00
39_S	43_A	0.911	1.00
11_I	69_G	0.909	1.00
61_E	64_G	0.887	1.00
61_E	65_V	0.885	1.00
16_E	19_P	0.844	1.00
13_N	53_L	0.838	1.00
48_M	51_E	0.826	1.00
49_V	57_I	0.805	1.00
50_L	55_L	0.794	1.00
42_R	59_R	0.781	1.00
17_V	49_V	0.780	1.00
37_A	41_D	0.773	1.00
57_I	71_L	0.751	1.00
17_V	52_D	0.746	1.00
47_T	51_E	0.746	1.00
43_A	47_T	0.744	1.00
21_L	45_I	0.743	1.00
70_E	73_E	0.739	1.00
45_I	71_L	0.729	1.00
33_V	37_A	0.715	1.00
30_D	35_L	0.695	1.00
31_Q	67_N	0.678	1.00
37_A	42_R	0.675	1.00
46_I	59_R	0.669	1.00
12_T	15_C	0.645	1.00
74_V	77_D	0.636	1.00
26_F	35_L	0.631	1.00
18_L	22_D	0.630	1.00
16_E	20_E	0.623	1.00
22_D	37_A	0.614	1.00
37_A	45_I	0.611	1.00
73_E	76_Y	0.607	1.00
33_V	63_S	0.604	1.00
30_D	34_E	0.604	1.00
55_L	75_L	0.598	1.00
10_L	75_L	0.598	1.00
43_A	59_R	0.591	1.00
73_E	77_D	0.585	1.00
20_E	52_D	0.585	1.00
65_V	73_E	0.581	1.00
68_I	72_A	0.580	1.00
49_V	55_L	0.572	1.00
21_L	44_E	0.564	1.00
38_D	59_R	0.558	1.00
66_K	70_E	0.554	1.00
62_L	71_L	0.553	1.00
11_I	15_C	0.552	1.00
19_P	24_H	0.547	1.00
39_S	63_S	0.547	1.00
17_V	21_L	0.536	1.00
11_I	68_I	0.529	1.00
21_L	41_D	0.526	1.00
10_L	72_A	0.521	1.00
19_P	26_F	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4r0mB	1	0.9268	99.5	0.16	Contact Map
4oqjA	2	0	99.5	0.185	Contact Map
2vsqA	1	1	99.5	0.189	Contact Map
2jgpA	1	1	99.5	0.19	Contact Map
2cq8A	1	1	99.4	0.204	Contact Map
4pxhB	1	0.9024	99.4	0.225	Contact Map
4dg8A	1	0	99.4	0.231	Contact Map
3tejA	1	0.9756	99.4	0.239	Contact Map
1dnyA	1	0.9146	99.3	0.249	Contact Map
2mr7A	1	1	99.3	0.253	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.