FRA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FRA - Intracellular iron chaperone frataxin

UniProt:	Q797E6	Sequences: MDVFSEYLAGIADPFHRERTEEVLTWIKNKYPNLHTEIKWNQPMFTDHGTFIIGFSVSKKHLAVAPEKVTIAHVEDDIVKAGYDYTEQLIRIPWNGPVDYTLLEKMIEFNILDKADCSTFWRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (122)
Sequences:	199 (143)
Seq/√Len:	12.9

BACSU - FRA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
90_I	106_M	3.977	1.00
77_D	105_K	3.958	1.00
30_K	104_E	3.486	0.99
31_Y	108_E	3.111	0.97
23_V	62_L	2.772	0.94
110_N	122_R	2.541	0.91
33_N	47_D	2.477	0.90
35_H	49_G	2.254	0.85
63_A	90_I	2.214	0.84
83_Y	92_I	2.181	0.83
84_D	91_R	2.047	0.79
11_I	16_H	2.003	0.78
20_T	62_L	1.971	0.76
42_Q	65_A	1.961	0.76
24_L	27_I	1.927	0.75
60_K	93_P	1.913	0.74
93_P	96_G	1.888	0.73
42_Q	55_F	1.810	0.70
68_K	88_Q	1.725	0.66
75_E	85_Y	1.641	0.62
47_D	117_C	1.620	0.61
13_D	16_H	1.616	0.61
71_I	85_Y	1.521	0.56
86_T	89_L	1.474	0.53
42_Q	56_S	1.470	0.53
109_F	115_A	1.446	0.52
31_Y	103_L	1.445	0.52
44_M	56_S	1.442	0.52
74_V	85_Y	1.399	0.50
109_F	113_D	1.385	0.49
31_Y	85_Y	1.378	0.48
3_V	10_G	1.360	0.48
24_L	87_E	1.353	0.47
7_Y	57_V	1.314	0.45
66_P	94_W	1.308	0.45
45_F	78_I	1.287	0.44
14_P	89_L	1.269	0.43
3_V	7_Y	1.254	0.42
31_Y	74_V	1.253	0.42
65_A	96_G	1.232	0.41
42_Q	63_A	1.222	0.40
27_I	55_F	1.215	0.40
5_S	25_T	1.202	0.39
101_T	104_E	1.182	0.38
8_L	17_R	1.150	0.37
48_H	117_C	1.139	0.36
53_I	66_P	1.137	0.36
20_T	71_I	1.116	0.35
47_D	81_A	1.115	0.35
86_T	115_A	1.109	0.35
17_R	21_E	1.079	0.34
22_E	97_P	1.069	0.33
107_I	122_R	1.046	0.32
58_S	87_E	1.040	0.32
26_W	100_Y	1.024	0.31
4_F	36_T	1.012	0.30
35_H	100_Y	0.991	0.30
112_L	115_A	0.988	0.29
58_S	84_D	0.971	0.29
16_H	80_K	0.968	0.29
63_A	69_V	0.960	0.28
75_E	79_V	0.953	0.28
68_K	86_T	0.949	0.28
48_H	116_D	0.943	0.28
79_V	92_I	0.935	0.27
39_K	63_A	0.930	0.27
92_I	96_G	0.925	0.27
15_F	96_G	0.921	0.27
59_K	83_Y	0.913	0.26
109_F	122_R	0.909	0.26
59_K	122_R	0.904	0.26
92_I	106_M	0.902	0.26
31_Y	105_K	0.902	0.26
79_V	85_Y	0.883	0.25
58_S	88_Q	0.882	0.25
14_P	38_I	0.879	0.25
45_F	53_I	0.876	0.25
57_V	62_L	0.872	0.25
33_N	62_L	0.867	0.24
71_I	75_E	0.865	0.24
57_V	113_D	0.862	0.24
70_T	106_M	0.861	0.24
59_K	110_N	0.846	0.24
29_N	70_T	0.846	0.24
13_D	80_K	0.844	0.24
49_G	116_D	0.843	0.24
65_A	70_T	0.841	0.23
18_E	39_K	0.839	0.23
37_E	88_Q	0.837	0.23
65_A	93_P	0.829	0.23
60_K	63_A	0.826	0.23
23_V	103_L	0.823	0.23
62_L	68_K	0.811	0.22
64_V	90_I	0.807	0.22
31_Y	34_L	0.799	0.22
24_L	105_K	0.791	0.22
50_T	103_L	0.787	0.22
66_P	109_F	0.784	0.21
72_A	101_T	0.779	0.21
10_G	30_K	0.770	0.21
78_I	81_A	0.768	0.21
12_A	73_H	0.764	0.21
6_E	51_F	0.743	0.20
58_S	64_V	0.738	0.20
68_K	72_A	0.737	0.20
63_A	87_E	0.736	0.20
10_G	17_R	0.732	0.20
66_P	113_D	0.730	0.20
72_A	81_A	0.730	0.20
3_V	38_I	0.727	0.19
110_N	113_D	0.723	0.19
108_E	112_L	0.716	0.19
68_K	84_D	0.716	0.19
84_D	90_I	0.714	0.19
5_S	30_K	0.713	0.19
55_F	94_W	0.695	0.18
9_A	27_I	0.683	0.18
81_A	116_D	0.679	0.18
12_A	95_N	0.678	0.18
107_I	110_N	0.676	0.18
83_Y	99_D	0.675	0.18
40_W	51_F	0.673	0.18
83_Y	98_V	0.672	0.18
55_F	119_T	0.671	0.18
16_H	44_M	0.667	0.18
58_S	116_D	0.662	0.17
47_D	111_I	0.661	0.17
64_V	103_L	0.658	0.17
87_E	119_T	0.650	0.17
113_D	122_R	0.648	0.17
78_I	92_I	0.647	0.17
15_F	37_E	0.645	0.17
54_G	87_E	0.642	0.17
27_I	74_V	0.639	0.17
12_A	16_H	0.634	0.17
63_A	88_Q	0.624	0.16
18_E	73_H	0.622	0.16
76_D	118_S	0.617	0.16
15_F	83_Y	0.609	0.16
31_Y	49_G	0.605	0.16
73_H	84_D	0.603	0.16
16_H	101_T	0.602	0.16
44_M	65_A	0.596	0.16
27_I	104_E	0.592	0.15
26_W	104_E	0.591	0.15
17_R	108_E	0.584	0.15
49_G	98_V	0.583	0.15
54_G	88_Q	0.582	0.15
112_L	119_T	0.580	0.15
30_K	37_E	0.576	0.15
42_Q	88_Q	0.574	0.15
92_I	98_V	0.573	0.15
36_T	78_I	0.571	0.15
31_Y	50_T	0.570	0.15
83_Y	106_M	0.567	0.15
5_S	80_K	0.563	0.15
37_E	73_H	0.562	0.15
26_W	103_L	0.559	0.15
81_A	99_D	0.559	0.15
30_K	76_D	0.552	0.14
51_F	54_G	0.551	0.14
16_H	112_L	0.550	0.14
29_N	101_T	0.545	0.14
16_H	72_A	0.540	0.14
112_L	118_S	0.536	0.14
93_P	116_D	0.535	0.14
36_T	74_V	0.533	0.14
47_D	116_D	0.532	0.14
66_P	122_R	0.532	0.14
23_V	90_I	0.527	0.14
80_K	87_E	0.526	0.14
12_A	41_N	0.525	0.14
85_Y	99_D	0.524	0.14
31_Y	36_T	0.524	0.14
74_V	93_P	0.523	0.14
6_E	14_P	0.521	0.14
12_A	18_E	0.519	0.14
19_R	62_L	0.519	0.14
85_Y	90_I	0.518	0.14
8_L	29_N	0.509	0.13
22_E	109_F	0.502	0.13
22_E	84_D	0.500	0.13
38_I	86_T	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2oc6A	1	1	100	0.542	Contact Map
2i8dA	2	0.9756	100	0.55	Contact Map
2kl4A	1	0.935	99.9	0.615	Contact Map
4hrrB	2	0.9024	17.2	0.954	Contact Map
3wctB	3	0.9106	15.5	0.955	Contact Map
3d3aA	1	0.9675	13.1	0.956	Contact Map
1b0bA	1	0.9024	12.7	0.956	Contact Map
2b9sA	1	0.7886	12	0.957	Contact Map
4hrrA	1	0.9024	11.5	0.957	Contact Map
3g46A	2	0.9024	10.6	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.