BCP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BCP - Putative peroxiredoxin YgaF

UniProt:	Q796Y8	Sequences: MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	157 (143)
Sequences:	12955 (8151)
Seq/√Len:	681.6

ECOLI - BCP AHPC TPX DSBE
BACSU - BCP YKUU AHPC TPX RESA YKUV STOA YNEN
HALSA - Q9HQE6 Q9HP28 Q9HN00 Q9HRG4
SULSO - Q97VL0 Q97WG5 Q97WP9 TDXH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_Y	127_K	3.339	1.00
13_E	21_T	2.860	1.00
62_L	152_K	2.769	1.00
53_R	87_P	2.652	1.00
40_D	77_H	2.478	1.00
16_G	20_E	2.452	1.00
9_A	102_F	2.413	1.00
13_E	23_K	2.353	1.00
30_K	65_V	2.326	1.00
126_D	132_I	2.317	1.00
15_K	21_T	2.273	1.00
56_H	60_A	2.242	1.00
8_K	130_R	2.192	1.00
55_S	58_S	2.054	1.00
106_K	119_E	1.967	1.00
11_D	25_S	1.956	1.00
126_D	130_R	1.886	1.00
4_E	7_Q	1.864	1.00
23_K	26_D	1.862	1.00
17_D	81_K	1.791	1.00
11_D	23_K	1.753	1.00
16_G	22_V	1.722	1.00
56_H	87_P	1.695	1.00
97_K	101_A	1.689	1.00
14_L	91_L	1.674	1.00
71_P	96_H	1.652	1.00
22_V	27_Y	1.623	1.00
133_K	150_T	1.609	1.00
14_L	98_L	1.598	1.00
49_A	86_L	1.552	1.00
71_P	99_A	1.531	1.00
16_G	89_L	1.379	1.00
33_V	124_L	1.362	1.00
64_A	151_L	1.360	1.00
32_I	65_V	1.343	1.00
27_Y	67_I	1.338	1.00
55_S	144_V	1.319	1.00
41_M	84_H	1.318	1.00
32_I	129_G	1.299	1.00
27_Y	32_I	1.279	1.00
28_K	32_I	1.279	1.00
60_A	65_V	1.278	1.00
41_M	79_K	1.275	1.00
125_I	131_L	1.268	1.00
99_A	118_I	1.264	1.00
51_D	55_S	1.252	1.00
78_G	82_E	1.239	1.00
145_A	149_Q	1.211	1.00
31_Y	132_I	1.199	1.00
55_S	145_A	1.178	1.00
31_Y	64_A	1.167	1.00
98_L	102_F	1.146	1.00
53_R	88_F	1.143	1.00
135_W	150_T	1.129	1.00
96_H	100_E	1.124	1.00
57_E	60_A	1.123	1.00
9_A	125_I	1.117	1.00
50_C	54_D	1.103	1.00
68_G	90_L	1.101	1.00
71_P	118_I	1.099	1.00
5_I	133_K	1.098	1.00
32_I	67_I	1.094	1.00
58_S	61_E	1.087	1.00
36_F	69_V	1.070	1.00
146_E	149_Q	1.065	1.00
107_L	116_M	1.053	1.00
104_V	121_S	1.053	1.00
96_H	105_W	1.042	1.00
25_S	28_K	1.038	1.00
65_V	89_L	1.035	1.00
16_G	91_L	1.023	1.00
35_Y	49_A	1.016	1.00
100_E	105_W	1.012	1.00
100_E	116_M	1.011	1.00
15_K	74_Q	1.011	1.00
28_K	129_G	1.004	1.00
58_S	148_L	0.991	1.00
51_D	54_D	0.985	1.00
41_M	83_K	0.965	1.00
18_H	78_G	0.953	1.00
75_E	79_K	0.947	1.00
33_V	122_T	0.941	1.00
47_T	141_K	0.935	1.00
32_I	125_I	0.923	1.00
24_L	32_I	0.917	1.00
50_C	53_R	0.914	1.00
79_K	82_E	0.910	1.00
124_L	150_T	0.909	1.00
149_Q	152_K	0.905	1.00
104_V	123_F	0.892	1.00
12_L	98_L	0.889	1.00
52_F	66_I	0.887	1.00
9_A	131_L	0.874	1.00
41_M	76_K	0.874	1.00
35_Y	88_F	0.870	1.00
12_L	102_F	0.867	1.00
78_G	81_K	0.861	1.00
142_D	145_A	0.859	1.00
11_D	24_L	0.859	1.00
46_T	84_H	0.854	1.00
34_L	125_I	0.851	1.00
58_S	152_K	0.847	1.00
53_R	57_E	0.844	1.00
63_D	127_K	0.839	1.00
67_I	91_L	0.834	1.00
97_K	100_E	0.833	1.00
74_Q	92_V	0.827	1.00
33_V	64_A	0.824	1.00
50_C	84_H	0.824	1.00
108_K	117_G	0.814	1.00
31_Y	63_D	0.813	1.00
73_S	76_K	0.811	1.00
31_Y	151_L	0.808	1.00
105_W	116_M	0.807	1.00
124_L	133_K	0.798	1.00
22_V	67_I	0.793	1.00
123_F	131_L	0.791	1.00
47_T	50_C	0.784	1.00
8_K	28_K	0.784	1.00
148_L	152_K	0.780	1.00
142_D	146_E	0.777	1.00
5_I	134_E	0.777	1.00
57_E	61_E	0.768	1.00
93_D	96_H	0.766	1.00
48_E	122_T	0.761	1.00
139_K	142_D	0.757	1.00
77_H	80_F	0.755	1.00
37_Y	68_G	0.752	1.00
57_E	87_P	0.748	1.00
99_A	105_W	0.744	1.00
96_H	99_A	0.743	1.00
35_Y	48_E	0.743	1.00
119_E	137_K	0.735	1.00
72_D	77_H	0.731	1.00
24_L	27_Y	0.730	1.00
75_E	78_G	0.729	1.00
31_Y	124_L	0.728	1.00
124_L	135_W	0.723	1.00
42_T	120_R	0.719	1.00
121_S	134_E	0.719	1.00
132_I	137_K	0.713	1.00
33_V	52_F	0.712	1.00
135_W	147_A	0.706	1.00
52_F	147_A	0.702	1.00
125_I	129_G	0.702	1.00
15_K	94_D	0.702	1.00
106_K	109_K	0.687	1.00
49_A	68_G	0.684	1.00
53_R	56_H	0.684	1.00
39_K	72_D	0.679	1.00
5_I	131_L	0.675	1.00
34_L	102_F	0.672	1.00
37_Y	40_D	0.664	1.00
122_T	147_A	0.662	1.00
17_D	78_G	0.655	1.00
38_P	42_T	0.655	1.00
123_F	134_E	0.653	1.00
9_A	24_L	0.650	1.00
4_E	134_E	0.647	1.00
56_H	65_V	0.641	1.00
73_S	94_D	0.641	1.00
18_H	81_K	0.639	1.00
36_F	104_V	0.637	1.00
39_K	117_G	0.633	1.00
62_L	151_L	0.627	1.00
7_Q	134_E	0.625	1.00
98_L	101_A	0.624	1.00
69_V	98_L	0.619	1.00
76_K	79_K	0.617	1.00
27_Y	65_V	0.613	1.00
119_E	136_R	0.613	1.00
58_S	62_L	0.613	1.00
74_Q	78_G	0.611	1.00
29_G	127_K	0.604	1.00
133_K	146_E	0.602	1.00
17_D	89_L	0.597	1.00
48_E	52_F	0.595	1.00
36_F	98_L	0.595	1.00
12_L	24_L	0.593	1.00
10_P	101_A	0.593	1.00
81_K	90_L	0.589	1.00
9_A	98_L	0.585	1.00
35_Y	122_T	0.585	1.00
51_D	144_V	0.576	1.00
106_K	117_G	0.576	1.00
136_R	140_V	0.575	1.00
55_S	59_F	0.575	1.00
62_L	148_L	0.574	1.00
33_V	151_L	0.572	1.00
59_F	148_L	0.570	1.00
109_K	116_M	0.570	1.00
135_W	146_E	0.567	1.00
40_D	76_K	0.560	1.00
35_Y	52_F	0.560	1.00
143_H	146_E	0.558	1.00
106_K	116_M	0.554	1.00
59_F	64_A	0.551	1.00
33_V	147_A	0.550	1.00
34_L	67_I	0.545	1.00
11_D	28_K	0.545	1.00
37_Y	80_F	0.538	1.00
68_G	88_F	0.534	1.00
72_D	76_K	0.532	1.00
36_F	102_F	0.531	1.00
135_W	143_H	0.529	1.00
99_A	104_V	0.528	1.00
22_V	26_D	0.524	1.00
66_I	88_F	0.516	0.99
80_F	84_H	0.516	0.99
47_T	51_D	0.514	0.99
28_K	128_E	0.512	0.99
39_K	42_T	0.511	0.99
44_G	139_K	0.502	0.99
132_I	150_T	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2v2gA	2	0.9873	100	0.235	Contact Map
1prxA	2	0.9936	100	0.243	Contact Map
1xccA	2	0.9873	100	0.248	Contact Map
3a2vA	5	0.9618	100	0.276	Contact Map
1xiyA	1	0.9554	100	0.282	Contact Map
3w6gA	6	0.9427	100	0.287	Contact Map
1xvwA	3	0.9554	100	0.291	Contact Map
3ixrA	1	0.9809	100	0.293	Contact Map
3sbcA	3	0.9618	100	0.307	Contact Map
3tjjA	3	0.9618	100	0.311	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.