RSIW - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RSIW - Anti-sigma-W factor RsiW

UniProt:	Q45588	Sequences: MSCPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEMEKSIALVRSTSHVEAPADFTANVMAKLPKEKKRASVKRWFRTHPVIAAAAVFIILMGGGFFNSWHNDHNFSVSKQPNLVVHNHTVTVPEGETVKGDVTVKNGKLIIKGKIDGDVTVVNGEKYMASAGQVTGQIEEINQLFDWTWYKMKSAGKSVLDAFNPNGEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (198)
Sequences:	184 (148)
Seq/√Len:	10.5

BACSU - RSIW

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_M	23_D	3.905	0.99
62_D	66_N	3.369	0.97
141_V	148_L	2.983	0.94
138_K	155_D	2.709	0.90
18_D	177_I	2.472	0.85
159_T	163_G	2.449	0.84
63_F	67_V	2.398	0.83
18_D	77_R	2.365	0.82
22_K	150_I	2.273	0.79
9_Q	189_Y	2.262	0.79
10_L	23_D	2.227	0.78
142_T	157_D	2.194	0.77
46_K	52_R	2.175	0.76
148_L	154_I	2.167	0.76
45_E	54_T	2.141	0.75
114_F	148_L	2.136	0.75
137_V	140_D	2.032	0.71
36_K	109_H	1.982	0.69
74_E	82_R	1.961	0.68
10_L	13_M	1.952	0.67
57_V	181_N	1.932	0.67
6_Q	111_D	1.912	0.66
11_M	41_F	1.904	0.65
43_E	59_A	1.852	0.63
114_F	159_T	1.844	0.63
7_I	11_M	1.816	0.62
150_I	165_K	1.786	0.60
117_S	143_V	1.755	0.59
147_K	164_E	1.693	0.56
23_D	80_V	1.680	0.55
113_N	142_T	1.659	0.54
28_N	98_I	1.651	0.54
48_I	51_V	1.644	0.54
18_D	187_T	1.626	0.53
114_F	181_N	1.560	0.50
108_W	186_W	1.540	0.49
24_E	137_V	1.526	0.48
48_I	60_P	1.520	0.48
42_Y	191_M	1.514	0.48
128_T	149_I	1.497	0.47
46_K	127_H	1.493	0.47
52_R	56_H	1.478	0.46
12_H	161_V	1.475	0.46
63_F	99_L	1.458	0.45
118_K	184_F	1.439	0.44
11_M	145_N	1.429	0.44
39_K	180_I	1.417	0.43
136_T	153_K	1.417	0.43
18_D	184_F	1.414	0.43
118_K	122_L	1.409	0.43
94_A	126_N	1.391	0.42
153_K	172_Q	1.380	0.41
183_L	190_K	1.360	0.40
1_M	117_S	1.341	0.40
111_D	150_I	1.338	0.39
24_E	28_N	1.337	0.39
160_V	163_G	1.337	0.39
49_A	177_I	1.305	0.38
33_T	106_N	1.284	0.37
62_D	65_A	1.278	0.37
1_M	116_V	1.277	0.37
115_S	124_V	1.275	0.37
52_R	57_V	1.257	0.36
12_H	15_L	1.231	0.35
9_Q	116_V	1.219	0.34
173_V	184_F	1.215	0.34
123_V	150_I	1.211	0.34
17_G	193_S	1.210	0.34
64_T	108_W	1.201	0.33
164_E	170_A	1.196	0.33
95_V	191_M	1.186	0.33
67_V	192_K	1.183	0.33
22_K	161_V	1.183	0.33
61_A	193_S	1.181	0.33
52_R	176_Q	1.178	0.32
86_T	130_T	1.168	0.32
65_A	69_A	1.165	0.32
23_D	180_I	1.158	0.32
95_V	99_L	1.154	0.31
70_K	189_Y	1.149	0.31
164_E	171_G	1.138	0.31
17_G	122_L	1.134	0.31
7_I	181_N	1.125	0.30
178_E	194_A	1.121	0.30
46_K	49_A	1.118	0.30
11_M	113_N	1.117	0.30
19_I	122_L	1.112	0.30
127_H	157_D	1.107	0.30
25_H	50_L	1.095	0.29
27_L	128_T	1.088	0.29
60_P	179_E	1.079	0.29
67_V	173_V	1.077	0.28
119_Q	123_V	1.072	0.28
170_A	173_V	1.064	0.28
134_G	179_E	1.060	0.28
97_I	127_H	1.056	0.28
38_R	91_A	1.047	0.27
7_I	130_T	1.042	0.27
20_L	191_M	1.040	0.27
38_R	176_Q	1.032	0.27
115_S	160_V	1.031	0.27
87_H	186_W	1.030	0.27
114_F	182_Q	1.029	0.27
17_G	142_T	1.018	0.26
74_E	78_A	1.015	0.26
94_A	105_F	1.014	0.26
180_I	187_T	1.009	0.26
140_D	182_Q	1.003	0.26
140_D	195_G	1.003	0.26
41_F	47_S	0.983	0.25
22_K	100_M	0.980	0.25
133_E	197_S	0.971	0.25
26_V	29_E	0.971	0.25
176_Q	182_Q	0.969	0.24
135_E	166_Y	0.967	0.24
94_A	137_V	0.954	0.24
104_F	109_H	0.938	0.23
82_R	174_T	0.938	0.23
150_I	164_E	0.937	0.23
52_R	142_T	0.928	0.23
116_V	181_N	0.926	0.23
85_R	153_K	0.924	0.23
126_N	190_K	0.921	0.23
30_H	37_C	0.921	0.23
106_N	127_H	0.917	0.23
131_V	158_V	0.915	0.23
109_H	178_E	0.914	0.23
100_M	118_K	0.913	0.23
67_V	99_L	0.911	0.23
94_A	110_N	0.909	0.22
18_D	197_S	0.903	0.22
12_H	171_G	0.903	0.22
14_H	176_Q	0.902	0.22
49_A	103_G	0.902	0.22
34_C	37_C	0.897	0.22
17_G	141_V	0.897	0.22
4_P	19_I	0.891	0.22
94_A	145_N	0.888	0.22
62_D	106_N	0.887	0.22
75_K	136_T	0.883	0.22
95_V	114_F	0.883	0.22
22_K	59_A	0.881	0.22
53_S	56_H	0.873	0.21
75_K	97_I	0.871	0.21
30_H	34_C	0.858	0.21
7_I	124_V	0.854	0.21
42_Y	185_D	0.850	0.21
63_F	192_K	0.840	0.20
7_I	141_V	0.834	0.20
39_K	43_E	0.830	0.20
53_S	85_R	0.830	0.20
125_H	172_Q	0.827	0.20
29_E	94_A	0.826	0.20
116_V	124_V	0.825	0.20
20_L	68_M	0.823	0.20
10_L	20_L	0.819	0.20
63_F	184_F	0.816	0.20
31_L	189_Y	0.814	0.20
46_K	55_S	0.810	0.19
77_R	172_Q	0.801	0.19
55_S	144_K	0.801	0.19
1_M	108_W	0.800	0.19
21_P	65_A	0.798	0.19
72_P	88_P	0.793	0.19
116_V	194_A	0.792	0.19
2_S	181_N	0.791	0.19
22_K	131_V	0.787	0.19
114_F	122_L	0.783	0.19
90_I	127_H	0.779	0.18
19_I	163_G	0.779	0.18
167_M	172_Q	0.777	0.18
84_F	127_H	0.774	0.18
160_V	194_A	0.768	0.18
52_R	60_P	0.760	0.18
58_E	61_A	0.759	0.18
65_A	183_L	0.759	0.18
17_G	94_A	0.759	0.18
83_W	87_H	0.755	0.18
73_K	112_H	0.753	0.18
76_K	106_N	0.751	0.18
83_W	168_A	0.751	0.18
12_H	160_V	0.748	0.18
48_I	57_V	0.747	0.18
65_A	89_V	0.743	0.17
48_I	199_L	0.741	0.17
74_E	184_F	0.739	0.17
165_K	174_T	0.738	0.17
28_N	32_E	0.738	0.17
121_N	135_E	0.737	0.17
75_K	164_E	0.737	0.17
35_E	102_G	0.736	0.17
17_G	102_G	0.734	0.17
13_M	97_I	0.730	0.17
58_E	193_S	0.726	0.17
39_K	98_I	0.716	0.17
25_H	111_D	0.710	0.17
135_E	177_I	0.706	0.17
18_D	123_V	0.705	0.16
114_F	174_T	0.701	0.16
4_P	174_T	0.697	0.16
18_D	145_N	0.695	0.16
168_A	188_W	0.693	0.16
127_H	153_K	0.690	0.16
94_A	141_V	0.685	0.16
66_N	89_V	0.685	0.16
104_F	107_S	0.684	0.16
58_E	120_P	0.682	0.16
136_T	187_T	0.677	0.16
115_S	179_E	0.668	0.16
148_L	160_V	0.667	0.16
33_T	98_I	0.666	0.15
2_S	123_V	0.666	0.15
136_T	182_Q	0.658	0.15
17_G	135_E	0.654	0.15
107_S	144_K	0.654	0.15
12_H	30_H	0.652	0.15
6_Q	42_Y	0.651	0.15
63_F	178_E	0.645	0.15
31_L	57_V	0.644	0.15
75_K	198_V	0.643	0.15
79_S	167_M	0.636	0.15
103_G	107_S	0.636	0.15
3_C	12_H	0.630	0.15
150_I	170_A	0.628	0.15
33_T	181_N	0.626	0.15
19_I	23_D	0.620	0.14
22_K	69_A	0.618	0.14
145_N	192_K	0.617	0.14
63_F	147_K	0.616	0.14
10_L	187_T	0.613	0.14
4_P	170_A	0.610	0.14
72_P	188_W	0.609	0.14
52_R	55_S	0.609	0.14
85_R	176_Q	0.607	0.14
20_L	144_K	0.606	0.14
47_S	62_D	0.605	0.14
123_V	159_T	0.605	0.14
84_F	150_I	0.603	0.14
48_I	52_R	0.603	0.14
44_M	50_L	0.600	0.14
61_A	90_I	0.599	0.14
26_V	125_H	0.594	0.14
111_D	119_Q	0.593	0.14
173_V	177_I	0.590	0.14
126_N	187_T	0.589	0.14
185_D	194_A	0.587	0.14
9_Q	107_S	0.586	0.14
51_V	151_K	0.584	0.14
136_T	155_D	0.576	0.13
64_T	170_A	0.571	0.13
162_N	180_I	0.570	0.13
104_F	191_M	0.570	0.13
120_P	125_H	0.570	0.13
185_D	196_K	0.568	0.13
18_D	147_K	0.565	0.13
162_N	170_A	0.565	0.13
80_V	174_T	0.564	0.13
106_N	121_N	0.562	0.13
6_Q	187_T	0.561	0.13
116_V	160_V	0.561	0.13
50_L	75_K	0.560	0.13
61_A	197_S	0.559	0.13
60_P	100_M	0.559	0.13
190_K	198_V	0.554	0.13
70_K	105_F	0.552	0.13
142_T	193_S	0.551	0.13
18_D	103_G	0.548	0.13
78_A	133_E	0.547	0.13
119_Q	157_D	0.543	0.13
11_M	163_G	0.540	0.13
3_C	16_D	0.540	0.13
38_R	42_Y	0.539	0.13
84_F	183_L	0.538	0.13
31_L	97_I	0.538	0.13
164_E	190_K	0.538	0.13
124_V	141_V	0.534	0.13
63_F	140_D	0.533	0.12
10_L	117_S	0.532	0.12
133_E	162_N	0.530	0.12
76_K	87_H	0.529	0.12
68_M	186_W	0.527	0.12
36_K	161_V	0.525	0.12
15_L	44_M	0.521	0.12
101_G	178_E	0.521	0.12
50_L	111_D	0.519	0.12
41_F	60_P	0.519	0.12
79_S	98_I	0.518	0.12
162_N	190_K	0.518	0.12
50_L	76_K	0.516	0.12
66_N	199_L	0.510	0.12
91_A	101_G	0.507	0.12
124_V	166_Y	0.507	0.12
77_R	136_T	0.506	0.12
43_E	167_M	0.503	0.12
53_S	100_M	0.502	0.12
61_A	157_D	0.501	0.12
69_A	187_T	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2q1zB	1	0.774	99.4	0.852	Contact Map
3hugB	2	0.2788	99.2	0.865	Contact Map
4nqwB	1	0.3269	99.2	0.869	Contact Map
1or7C	1	0.3173	97.9	0.911	Contact Map
2zxeA	1	0.8413	93.1	0.943	Contact Map
3ixzA	1	0.8654	91.6	0.945	Contact Map
3b8cA	1	0.8173	83.5	0.952	Contact Map
1mhsA	2	0.9663	80.8	0.954	Contact Map
1dbgA	1	0.4375	65.4	0.959	Contact Map
3ar4A	1	0.7933	64.6	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.