YBBJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YBBJ - Uncharacterized N-acetyltransferase YbbJ

UniProt:	Q45583	Sequences: MTQDISLSFYKPEHLPELQSFTLTNDDKRFTSLPKEVLSQALGIQDRYPVVILKDDLPVGFFILHASKETLASYSNNPFALLLSSLSLTAVHHGKGYAKKAMLLLPAFVSGYFPWCDEIILAVNHLNIRAKHLYMKSGFLDKGRRRIGPLGEQLILHHFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (140)
Sequences:	1387 (1055)
Seq/√Len:	89.2

BACSU - YBBJ BLTD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
99_K	136_K	3.366	1.00
34_P	87_S	3.188	1.00
52_I	101_A	3.144	1.00
60_G	88_L	2.943	1.00
54_K	97_Y	2.801	1.00
27_D	93_H	2.800	1.00
25_N	28_K	2.590	1.00
49_P	61_F	2.506	1.00
18_L	58_P	2.389	1.00
18_L	51_V	2.310	1.00
53_L	58_P	2.295	1.00
24_T	90_A	2.283	1.00
62_F	105_L	2.278	1.00
8_S	53_L	2.260	1.00
57_L	92_H	2.207	1.00
52_I	60_G	2.192	1.00
123_V	152_E	2.104	1.00
39_S	43_G	2.060	1.00
59_V	97_Y	2.042	1.00
92_H	95_K	1.959	1.00
88_L	97_Y	1.838	1.00
123_V	131_K	1.812	1.00
127_N	130_A	1.787	1.00
131_K	135_M	1.766	1.00
50_V	108_F	1.760	1.00
21_F	87_S	1.716	1.00
22_T	90_A	1.708	1.00
32_S	85_S	1.685	1.00
41_A	49_P	1.642	1.00
6_S	56_D	1.483	1.00
37_V	85_S	1.475	1.00
102_M	137_S	1.447	0.99
131_K	141_D	1.377	0.99
83_L	102_M	1.348	0.99
10_Y	51_V	1.328	0.99
83_L	121_L	1.324	0.99
121_L	134_Y	1.316	0.99
37_V	63_I	1.294	0.99
130_A	133_L	1.287	0.99
23_L	27_D	1.273	0.99
135_M	141_D	1.243	0.98
50_V	64_L	1.231	0.98
59_V	101_A	1.231	0.98
47_R	84_S	1.226	0.98
130_A	134_Y	1.225	0.98
40_Q	85_S	1.217	0.98
79_F	117_D	1.212	0.98
121_L	130_A	1.198	0.98
52_I	88_L	1.196	0.98
100_K	103_L	1.172	0.97
82_L	120_I	1.166	0.97
122_A	146_R	1.165	0.97
103_L	107_A	1.164	0.97
81_L	116_C	1.160	0.97
107_A	110_S	1.159	0.97
34_P	85_S	1.157	0.97
47_R	65_H	1.154	0.97
8_S	14_H	1.144	0.97
65_H	82_L	1.133	0.97
106_P	110_S	1.133	0.97
99_K	103_L	1.124	0.97
19_Q	35_K	1.123	0.97
34_P	37_V	1.121	0.97
53_L	56_D	1.110	0.96
86_L	102_M	1.107	0.96
14_H	53_L	1.101	0.96
37_V	61_F	1.097	0.96
15_L	19_Q	1.091	0.96
31_T	87_S	1.085	0.96
11_K	14_H	1.069	0.96
7_L	101_A	1.065	0.96
106_P	119_I	1.013	0.94
104_L	107_A	1.012	0.94
21_F	34_P	0.996	0.94
12_P	45_Q	0.989	0.93
65_H	84_S	0.988	0.93
5_I	54_K	0.976	0.93
16_P	36_E	0.971	0.93
7_L	52_I	0.970	0.93
99_K	133_L	0.950	0.92
86_L	101_A	0.946	0.92
80_A	118_E	0.943	0.92
118_E	153_Q	0.920	0.91
59_V	92_H	0.919	0.91
15_L	43_G	0.912	0.90
144_R	151_G	0.907	0.90
132_H	135_M	0.906	0.90
63_I	85_S	0.906	0.90
133_L	137_S	0.903	0.90
109_V	116_C	0.902	0.90
37_V	87_S	0.896	0.89
77_N	118_E	0.895	0.89
17_E	57_L	0.893	0.89
29_R	126_L	0.890	0.89
63_I	84_S	0.887	0.89
32_S	84_S	0.856	0.87
127_N	133_L	0.856	0.87
121_L	127_N	0.832	0.86
10_Y	14_H	0.825	0.85
51_V	58_P	0.820	0.85
60_G	93_H	0.807	0.84
116_C	119_I	0.800	0.83
98_A	129_R	0.782	0.82
17_E	58_P	0.774	0.81
54_K	95_K	0.765	0.81
105_L	109_V	0.764	0.80
64_L	105_L	0.764	0.80
54_K	100_K	0.762	0.80
54_K	59_V	0.758	0.80
15_L	36_E	0.750	0.79
124_N	152_E	0.748	0.79
8_S	11_K	0.740	0.78
64_L	84_S	0.737	0.78
44_I	47_R	0.734	0.78
10_Y	98_A	0.719	0.76
128_I	132_H	0.713	0.76
82_L	122_A	0.705	0.75
77_N	80_A	0.704	0.75
83_L	86_L	0.704	0.75
124_N	153_Q	0.701	0.75
82_L	151_G	0.698	0.74
66_A	115_W	0.694	0.74
30_F	124_N	0.693	0.74
13_E	17_E	0.691	0.73
115_W	129_R	0.689	0.73
137_S	148_G	0.687	0.73
34_P	61_F	0.676	0.72
39_S	42_L	0.667	0.71
141_D	145_R	0.667	0.71
85_S	149_P	0.655	0.69
118_E	143_G	0.650	0.69
31_T	121_L	0.645	0.68
47_R	63_I	0.643	0.68
83_L	137_S	0.638	0.67
5_I	97_Y	0.638	0.67
103_L	106_P	0.633	0.67
133_L	136_K	0.633	0.67
26_D	95_K	0.632	0.67
141_D	152_E	0.631	0.67
39_S	44_I	0.628	0.66
107_A	111_G	0.626	0.66
6_S	104_L	0.625	0.66
145_R	152_E	0.623	0.66
65_H	146_R	0.622	0.65
82_L	121_L	0.618	0.65
48_Y	112_Y	0.617	0.65
88_L	93_H	0.614	0.64
17_E	20_S	0.614	0.64
31_T	49_P	0.605	0.63
18_L	34_P	0.604	0.63
98_A	149_P	0.603	0.63
26_D	29_R	0.602	0.63
80_A	144_R	0.600	0.63
99_K	105_L	0.600	0.63
50_V	82_L	0.600	0.63
5_I	59_V	0.599	0.63
46_D	67_S	0.589	0.61
89_T	139_F	0.588	0.61
17_E	54_K	0.585	0.61
55_D	111_G	0.584	0.61
15_L	44_I	0.580	0.60
14_H	98_A	0.575	0.59
124_N	151_G	0.573	0.59
10_Y	58_P	0.572	0.59
50_V	62_F	0.572	0.59
18_L	86_L	0.568	0.59
64_L	123_V	0.565	0.58
17_E	103_L	0.564	0.58
31_T	85_S	0.563	0.58
23_L	34_P	0.559	0.57
65_H	105_L	0.559	0.57
22_T	35_K	0.558	0.57
31_T	124_N	0.554	0.57
29_R	141_D	0.554	0.57
10_Y	18_L	0.551	0.56
5_I	52_I	0.551	0.56
77_N	120_I	0.551	0.56
15_L	39_S	0.548	0.56
33_L	55_D	0.547	0.56
52_I	97_Y	0.544	0.55
5_I	100_K	0.541	0.55
34_P	38_L	0.539	0.55
7_L	104_L	0.539	0.55
38_L	98_A	0.538	0.54
54_K	92_H	0.536	0.54
146_R	152_E	0.535	0.54
48_Y	64_L	0.534	0.54
123_V	130_A	0.533	0.54
95_K	126_L	0.532	0.54
12_P	43_G	0.531	0.54
32_S	40_Q	0.531	0.54
108_F	112_Y	0.531	0.54
55_D	128_I	0.530	0.53
21_F	58_P	0.529	0.53
49_P	63_I	0.527	0.53
129_R	132_H	0.522	0.52
125_H	152_E	0.521	0.52
27_D	129_R	0.520	0.52
9_F	20_S	0.518	0.52
62_F	83_L	0.518	0.52
35_K	39_S	0.518	0.52
19_Q	87_S	0.517	0.52
29_R	56_D	0.515	0.51
8_S	57_L	0.514	0.51
103_L	137_S	0.514	0.51
67_S	84_S	0.513	0.51
46_D	111_G	0.512	0.51
31_T	63_I	0.512	0.51
15_L	119_I	0.502	0.50
12_P	15_L	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fl4A	2	0.9125	99.8	0.554	Contact Map
3fixA	2	0.8938	99.8	0.577	Contact Map
4qc6A	1	0.9938	99.8	0.584	Contact Map
3kkwA	1	0.925	99.8	0.584	Contact Map
1tiqA	1	0.9563	99.8	0.585	Contact Map
2r7hA	2	0.9125	99.8	0.585	Contact Map
2qmlA	2	0.9812	99.8	0.586	Contact Map
1s3zA	2	0.9187	99.8	0.586	Contact Map
3tthA	5	0.9313	99.8	0.587	Contact Map
1nslA	3	0.9437	99.8	0.587	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.