COTJB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COTJB - Protein CotJB

UniProt:	Q45537	Sequences: MAKKVDAEYYRQLEQIQAADFVLVELSLYLNTHPHDEDALKQFNQYSGYSRHLKRQFESSYGPLLQFGNSPAGKDWDWGKGPWPWQV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	87 (80)
Sequences:	484 (409)
Seq/√Len:	45.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_D	50_S	3.579	1.00
26_L	42_Q	3.134	1.00
16_I	50_S	2.782	1.00
50_S	54_K	2.619	1.00
22_V	46_Y	2.095	1.00
14_E	18_A	2.079	1.00
14_E	17_Q	1.928	0.99
16_I	53_L	1.866	0.99
56_Q	60_S	1.863	0.99
27_S	66_Q	1.833	0.99
9_Y	57_F	1.787	0.98
15_Q	49_Y	1.774	0.98
65_L	69_N	1.746	0.98
8_E	11_R	1.731	0.98
58_E	68_G	1.718	0.98
16_I	54_K	1.666	0.98
27_S	31_N	1.642	0.97
24_V	27_S	1.640	0.97
40_L	44_N	1.630	0.97
19_A	53_L	1.586	0.97
8_E	60_S	1.574	0.97
29_Y	36_D	1.508	0.96
49_Y	53_L	1.489	0.95
36_D	39_A	1.482	0.95
19_A	46_Y	1.466	0.95
49_Y	52_H	1.459	0.95
72_A	75_D	1.442	0.94
77_D	80_K	1.399	0.93
54_K	58_E	1.383	0.93
73_G	77_D	1.350	0.92
81_G	86_Q	1.339	0.92
23_L	69_N	1.302	0.91
20_D	23_L	1.251	0.89
47_S	51_R	1.136	0.84
75_D	80_K	1.094	0.81
44_N	72_A	1.050	0.78
38_D	41_K	1.028	0.77
17_Q	25_E	1.023	0.77
13_L	64_L	1.016	0.76
27_S	86_Q	0.999	0.75
36_D	83_W	0.985	0.74
44_N	75_D	0.984	0.74
25_E	64_L	0.974	0.73
51_R	73_G	0.952	0.71
24_V	67_F	0.935	0.70
20_D	25_E	0.933	0.70
9_Y	86_Q	0.899	0.67
12_Q	57_F	0.896	0.67
21_F	29_Y	0.852	0.63
48_G	52_H	0.842	0.62
43_F	66_Q	0.837	0.61
37_E	60_S	0.829	0.61
62_G	83_W	0.825	0.60
29_Y	46_Y	0.823	0.60
25_E	69_N	0.804	0.58
55_R	59_S	0.796	0.57
22_V	32_T	0.796	0.57
22_V	33_H	0.794	0.57
79_G	83_W	0.789	0.57
16_I	25_E	0.758	0.54
46_Y	77_D	0.748	0.53
59_S	76_W	0.746	0.53
31_N	86_Q	0.741	0.52
26_L	78_W	0.739	0.52
10_Y	14_E	0.734	0.51
19_A	49_Y	0.714	0.49
9_Y	81_G	0.714	0.49
8_E	37_E	0.700	0.48
35_H	79_G	0.685	0.47
13_L	71_P	0.684	0.46
20_D	67_F	0.674	0.45
20_D	54_K	0.672	0.45
23_L	43_F	0.670	0.45
26_L	53_L	0.668	0.45
32_T	39_A	0.664	0.45
13_L	49_Y	0.658	0.44
31_N	79_G	0.654	0.44
8_E	45_Q	0.653	0.43
11_R	15_Q	0.652	0.43
24_V	50_S	0.644	0.43
13_L	61_Y	0.644	0.43
55_R	58_E	0.638	0.42
51_R	55_R	0.631	0.41
49_Y	86_Q	0.628	0.41
25_E	71_P	0.618	0.40
48_G	59_S	0.617	0.40
30_L	85_W	0.610	0.39
24_V	28_L	0.602	0.39
37_E	40_L	0.594	0.38
31_N	78_W	0.584	0.37
33_H	63_P	0.582	0.37
20_D	24_V	0.577	0.36
43_F	78_W	0.575	0.36
37_E	48_G	0.574	0.36
15_Q	53_L	0.568	0.36
51_R	56_Q	0.556	0.34
23_L	47_S	0.555	0.34
16_I	58_E	0.552	0.34
7_A	13_L	0.551	0.34
70_S	75_D	0.549	0.34
22_V	42_Q	0.546	0.34
31_N	65_L	0.543	0.33
14_E	35_H	0.540	0.33
12_Q	53_L	0.540	0.33
44_N	74_K	0.540	0.33
11_R	18_A	0.539	0.33
14_E	59_S	0.538	0.33
9_Y	61_Y	0.536	0.33
14_E	57_F	0.535	0.33
16_I	26_L	0.534	0.33
24_V	66_Q	0.532	0.32
46_Y	61_Y	0.532	0.32
82_P	85_W	0.529	0.32
37_E	74_K	0.529	0.32
23_L	66_Q	0.525	0.32
40_L	79_G	0.523	0.32
31_N	52_H	0.517	0.31
24_V	29_Y	0.509	0.30
55_R	73_G	0.505	0.30
46_Y	73_G	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ds1A	2	0.5632	21.9	0.916	Contact Map
4v0qA	2	0.954	14.6	0.922	Contact Map
1yo3A	2	0.5747	12.7	0.925	Contact Map
2mnuB	1	0.2299	12.1	0.925	Contact Map
3rjsA	2	0.7356	10	0.928	Contact Map
1hyuA	2	0.9655	7.8	0.931	Contact Map
3rczB	1	0.6552	6.9	0.933	Contact Map
2fbnA	2	0.6092	6.3	0.934	Contact Map
3czqA	3	0.9655	5.8	0.935	Contact Map
3rkvA	1	0.6322	5.7	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.