COTJA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COTJA - Protein CotJA

UniProt:	Q45536	Sequences: MKDMQPFTPVKSYTPFHSRFDPCPPIGKKYYRTPPNLYMTFQPEHMEQFSPMEALRKGTLWKDLYDFYENPYRGGDAHGKKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	82 (68)
Sequences:	139 (101)
Seq/√Len:	12.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_K	38_Y	5.194	1.00
11_K	33_T	3.210	0.97
9_P	66_D	2.524	0.90
39_M	63_D	2.286	0.85
53_E	57_K	2.214	0.83
50_S	56_R	1.917	0.72
33_T	37_L	1.905	0.72
17_H	27_G	1.778	0.66
47_E	62_K	1.712	0.63
11_K	37_L	1.596	0.58
62_K	69_E	1.582	0.57
32_R	36_N	1.513	0.53
29_K	35_P	1.490	0.52
10_V	32_R	1.489	0.52
17_H	37_L	1.477	0.52
33_T	71_P	1.363	0.46
10_V	67_F	1.352	0.45
26_I	29_K	1.297	0.42
14_T	28_K	1.275	0.41
65_Y	74_G	1.269	0.41
52_M	56_R	1.236	0.39
19_R	47_E	1.216	0.39
8_T	11_K	1.186	0.37
46_M	49_F	1.162	0.36
50_S	53_E	1.146	0.35
66_D	73_R	1.094	0.33
69_E	73_R	1.086	0.32
16_F	19_R	1.085	0.32
50_S	57_K	1.069	0.32
14_T	24_P	1.065	0.32
38_Y	56_R	1.014	0.29
47_E	74_G	1.011	0.29
13_Y	28_K	1.003	0.29
41_F	45_H	0.991	0.28
9_P	62_K	0.988	0.28
10_V	30_Y	0.987	0.28
33_T	38_Y	0.974	0.28
12_S	75_G	0.974	0.28
17_H	28_K	0.917	0.25
17_H	67_F	0.915	0.25
40_T	63_D	0.908	0.25
31_Y	38_Y	0.899	0.25
18_S	52_M	0.896	0.25
45_H	51_P	0.887	0.24
47_E	63_D	0.885	0.24
8_T	13_Y	0.884	0.24
45_H	57_K	0.882	0.24
13_Y	37_L	0.877	0.24
8_T	33_T	0.864	0.23
30_Y	69_E	0.855	0.23
9_P	67_F	0.849	0.23
40_T	64_L	0.843	0.23
41_F	44_E	0.831	0.22
20_F	63_D	0.801	0.21
12_S	30_Y	0.794	0.21
27_G	41_F	0.793	0.21
14_T	27_G	0.782	0.21
8_T	16_F	0.781	0.21
39_M	46_M	0.764	0.20
32_R	66_D	0.725	0.19
15_P	43_P	0.722	0.19
69_E	72_Y	0.719	0.19
46_M	61_W	0.714	0.18
66_D	70_N	0.710	0.18
49_F	70_N	0.708	0.18
27_G	32_R	0.701	0.18
31_Y	70_N	0.686	0.18
8_T	14_T	0.685	0.18
40_T	71_P	0.681	0.17
8_T	44_E	0.675	0.17
9_P	64_L	0.672	0.17
16_F	70_N	0.666	0.17
9_P	27_G	0.656	0.17
24_P	39_M	0.652	0.17
30_Y	67_F	0.652	0.17
57_K	64_L	0.650	0.17
24_P	47_E	0.642	0.16
32_R	72_Y	0.637	0.16
55_L	59_T	0.630	0.16
44_E	49_F	0.620	0.16
15_P	55_L	0.617	0.16
16_F	57_K	0.603	0.15
27_G	67_F	0.602	0.15
12_S	49_F	0.599	0.15
15_P	39_M	0.592	0.15
20_F	62_K	0.590	0.15
12_S	28_K	0.581	0.15
27_G	30_Y	0.564	0.14
32_R	39_M	0.555	0.14
34_P	71_P	0.555	0.14
34_P	73_R	0.554	0.14
12_S	66_D	0.549	0.14
19_R	63_D	0.545	0.14
14_T	47_E	0.545	0.14
10_V	27_G	0.531	0.13
12_S	40_T	0.523	0.13
11_K	45_H	0.518	0.13
9_P	38_Y	0.517	0.13
51_P	72_Y	0.508	0.13
8_T	38_Y	0.507	0.13
59_T	71_P	0.505	0.13
50_S	65_Y	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hcjA	1	0.878	2.3	0.953	Contact Map
1l2lA	1	0.2683	2.1	0.954	Contact Map
1t3cA	2	0.7927	1.8	0.956	Contact Map
4hjzA	1	0.8293	1.7	0.956	Contact Map
3maoA	1	0.5976	1.5	0.958	Contact Map
3ffzA	1	0.8049	1.4	0.958	Contact Map
2fpqA	1	0.7805	1.2	0.959	Contact Map
3qr0A	1	0.378	1.2	0.959	Contact Map
2qn0A	1	0.7805	1.2	0.959	Contact Map
2a97A	1	0.7927	1.2	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.