YNET - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNET - Uncharacterized protein YneT

UniProt:	Q45065	Sequences: MQNPSKAEIKEILQRSKRIAVVGLSDRPDRTSHMVSKAMQDAGYEIIPVNPTIDEALGVKAVSSLKEIDGPIDIVNVFRRSEQLPGVAEEFLETDAPVFWAQQGLVNEEAYQMLKEKGRTVIMDLCIKVAHAVTK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	135 (126)
Sequences:	1866 (1270)
Seq/√Len:	113.1

ECOLI - YCCU
BACSU - YNET
HALSA - Q9HRP2
SULSO - Q97Z29

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_S	67_E	3.491	1.00
89_E	113_M	2.888	1.00
38_A	131_H	2.456	1.00
45_E	59_V	2.369	1.00
18_R	45_E	2.351	1.00
112_Q	116_E	2.238	1.00
40_Q	59_V	2.236	1.00
16_S	74_I	2.160	1.00
62_V	69_D	2.127	1.00
63_S	67_E	2.118	1.00
68_I	72_I	2.114	1.00
85_P	107_N	2.072	1.00
66_K	90_E	2.056	1.00
103_Q	129_V	2.056	1.00
88_A	99_F	2.010	1.00
26_D	53_I	1.812	1.00
66_K	93_E	1.811	1.00
24_L	36_S	1.801	1.00
37_K	41_D	1.781	1.00
11_E	15_R	1.777	1.00
45_E	70_G	1.766	1.00
12_I	98_V	1.695	1.00
111_Y	123_M	1.685	1.00
10_K	14_Q	1.633	1.00
84_L	101_A	1.619	1.00
47_I	70_G	1.557	1.00
18_R	70_G	1.551	1.00
71_P	97_P	1.548	1.00
65_L	94_T	1.437	1.00
88_A	110_A	1.410	1.00
27_R	30_R	1.391	1.00
106_V	124_D	1.374	1.00
53_I	56_A	1.374	1.00
49_V	68_I	1.372	1.00
55_E	60_K	1.318	1.00
56_A	61_A	1.303	0.99
42_A	131_H	1.300	0.99
85_P	113_M	1.295	0.99
83_Q	86_G	1.279	0.99
125_L	130_A	1.277	0.99
74_I	127_I	1.226	0.99
72_I	94_T	1.224	0.99
16_S	98_V	1.222	0.99
92_L	117_K	1.218	0.99
111_Y	121_V	1.205	0.99
86_G	89_E	1.188	0.99
77_V	101_A	1.185	0.99
92_L	113_M	1.164	0.99
108_E	123_M	1.163	0.99
34_M	128_K	1.160	0.99
113_M	117_K	1.157	0.99
40_Q	57_L	1.157	0.99
98_V	120_T	1.136	0.99
112_Q	115_K	1.115	0.98
18_R	47_I	1.112	0.98
111_Y	115_K	1.112	0.98
74_I	98_V	1.108	0.98
6_K	130_A	1.104	0.98
80_R	83_Q	1.090	0.98
77_V	99_F	1.085	0.98
92_L	119_R	1.085	0.98
114_L	119_R	1.082	0.98
16_S	73_D	1.078	0.98
21_V	46_I	1.070	0.98
31_T	34_M	1.067	0.98
88_A	114_L	1.052	0.98
103_Q	130_A	1.038	0.97
19_I	127_I	1.019	0.97
33_H	37_K	1.009	0.97
19_I	74_I	0.996	0.97
108_E	112_Q	0.988	0.97
21_V	36_S	0.987	0.97
31_T	35_V	0.986	0.97
99_F	114_L	0.981	0.96
106_V	123_M	0.974	0.96
25_S	32_S	0.971	0.96
11_E	120_T	0.965	0.96
79_R	83_Q	0.964	0.96
64_S	90_E	0.964	0.96
22_V	75_V	0.952	0.96
40_Q	46_I	0.939	0.95
84_L	105_L	0.932	0.95
8_E	120_T	0.932	0.95
38_A	128_K	0.931	0.95
30_R	80_R	0.917	0.95
76_N	127_I	0.914	0.95
85_P	89_E	0.911	0.95
96_A	119_R	0.905	0.94
92_L	96_A	0.869	0.93
27_R	52_T	0.866	0.93
78_F	102_Q	0.864	0.93
85_P	109_E	0.855	0.93
40_Q	45_E	0.852	0.92
34_M	37_K	0.846	0.92
24_L	56_A	0.845	0.92
54_D	63_S	0.830	0.91
101_A	121_V	0.827	0.91
53_I	61_A	0.821	0.91
107_N	110_A	0.813	0.91
55_E	61_A	0.812	0.91
107_N	113_M	0.806	0.90
50_N	53_I	0.804	0.90
22_V	91_F	0.800	0.90
95_D	119_R	0.798	0.90
11_E	14_Q	0.782	0.89
91_F	119_R	0.773	0.88
19_I	44_Y	0.762	0.88
15_R	97_P	0.761	0.88
54_D	60_K	0.760	0.87
39_M	127_I	0.752	0.87
26_D	52_T	0.749	0.87
35_V	78_F	0.748	0.87
47_I	68_I	0.727	0.85
33_H	57_L	0.718	0.84
12_I	122_I	0.712	0.84
62_V	68_I	0.710	0.84
89_E	93_E	0.706	0.83
91_F	99_F	0.693	0.82
29_D	34_M	0.692	0.82
25_S	87_V	0.691	0.82
39_M	46_I	0.685	0.81
32_S	36_S	0.679	0.81
84_L	107_N	0.675	0.80
38_A	42_A	0.673	0.80
48_P	61_A	0.662	0.79
55_E	58_G	0.661	0.79
103_Q	128_K	0.651	0.78
86_G	90_E	0.650	0.78
28_P	33_H	0.650	0.78
6_K	10_K	0.644	0.77
88_A	92_L	0.643	0.77
81_S	107_N	0.642	0.77
24_L	46_I	0.641	0.77
36_S	39_M	0.635	0.76
7_A	10_K	0.635	0.76
36_S	46_I	0.633	0.76
92_L	95_D	0.626	0.75
9_I	125_L	0.624	0.75
26_D	33_H	0.623	0.75
108_E	111_Y	0.621	0.75
35_V	102_Q	0.620	0.75
77_V	84_L	0.618	0.74
46_I	59_V	0.618	0.74
26_D	56_A	0.618	0.74
34_M	38_A	0.615	0.74
48_P	60_K	0.614	0.74
8_E	11_E	0.612	0.74
97_P	120_T	0.610	0.73
28_P	37_K	0.608	0.73
91_F	95_D	0.607	0.73
68_I	94_T	0.607	0.73
30_R	105_L	0.604	0.73
101_A	114_L	0.591	0.71
22_V	87_V	0.591	0.71
36_S	57_L	0.582	0.70
77_V	87_V	0.582	0.70
9_I	122_I	0.570	0.68
103_Q	106_V	0.569	0.68
50_N	61_A	0.569	0.68
26_D	32_S	0.567	0.68
21_V	24_L	0.567	0.68
76_N	102_Q	0.564	0.68
88_A	113_M	0.562	0.67
116_E	119_R	0.557	0.67
59_V	62_V	0.555	0.66
73_D	97_P	0.554	0.66
24_L	35_V	0.550	0.66
127_I	131_H	0.542	0.64
8_E	12_I	0.542	0.64
86_G	107_N	0.541	0.64
81_S	105_L	0.540	0.64
8_E	15_R	0.530	0.63
16_S	127_I	0.529	0.63
25_S	50_N	0.528	0.62
6_K	125_L	0.528	0.62
91_F	96_A	0.526	0.62
13_L	44_Y	0.526	0.62
24_L	40_Q	0.525	0.62
28_P	35_V	0.524	0.62
89_E	92_L	0.522	0.62
24_L	61_A	0.512	0.60
115_K	120_T	0.512	0.60
7_A	11_E	0.511	0.60
50_N	80_R	0.508	0.60
88_A	107_N	0.506	0.59
60_K	67_E	0.506	0.59
34_M	41_D	0.504	0.59
26_D	50_N	0.503	0.59
32_S	78_F	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ff4A	1	0.8889	100	0.467	Contact Map
2csuA	2	0.9333	99.9	0.523	Contact Map
2duwA	1	0.9778	99.9	0.575	Contact Map
1iukA	1	0.9778	99.8	0.58	Contact Map
1y81A	1	0.8593	99.8	0.6	Contact Map
2d59A	1	1	99.8	0.606	Contact Map
3pffA	2	0.9037	99.7	0.639	Contact Map
2fp4A	1	0.963	99.6	0.667	Contact Map
2yv1A	1	0.9037	99.5	0.688	Contact Map
3mwdB	1	0.9037	99.5	0.689	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.