PLSY - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PLSY - Glycerol-3-phosphate acyltransferase

UniProt:	Q45064	Sequences: MLIALLIILAYLIGSIPSGLIVGKLAKGIDIREHGSGNLGATNAFRTLGVKAGSVVIAGDILKGTLATALPFLMHVDIHPLLAGVFAVLGHVFPIFAKFKGGKAVATSGGVLLFYAPLLFITMVAVFFIFLYLTKFVSLSSMLTGIYTVIYSFFVHDTYLLIVVTLLTIFVIYRHRANIKRIINKTEPKVKWL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	193 (187)
Sequences:	3196 (2353)
Seq/√Len:	172.0

ECOLI - PLSY
BACSU - PLSY

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_S	59_G	4.063	1.00
19_G	39_L	3.401	1.00
7_I	86_F	3.343	1.00
142_M	172_I	3.007	1.00
84_G	111_V	2.826	1.00
65_T	114_F	2.723	1.00
130_F	143_L	2.633	1.00
180_K	184_N	2.445	1.00
45_F	53_G	2.319	1.00
17_P	97_A	2.312	1.00
64_G	107_T	2.309	1.00
131_L	140_S	2.302	1.00
11_Y	95_I	2.236	1.00
89_L	93_F	2.181	1.00
173_Y	176_R	2.130	1.00
136_F	182_I	2.128	1.00
126_V	151_Y	2.121	1.00
15_S	96_F	1.962	1.00
92_V	104_A	1.893	1.00
13_I	67_A	1.879	1.00
34_H	47_T	1.828	1.00
88_V	108_S	1.768	1.00
6_L	83_A	1.758	1.00
105_V	171_V	1.757	1.00
22_V	52_A	1.735	1.00
29_I	34_H	1.719	1.00
57_I	61_I	1.689	1.00
17_P	39_L	1.679	1.00
131_L	190_V	1.644	1.00
30_D	33_E	1.640	1.00
94_P	97_A	1.592	1.00
41_A	106_A	1.559	1.00
152_S	164_V	1.556	1.00
62_L	65_T	1.556	1.00
20_L	97_A	1.544	1.00
180_K	183_I	1.534	1.00
92_V	174_R	1.468	1.00
134_T	140_S	1.462	1.00
21_I	25_L	1.458	1.00
177_A	181_R	1.458	1.00
146_I	172_I	1.453	1.00
149_V	165_T	1.431	1.00
176_R	180_K	1.416	1.00
41_A	57_I	1.414	1.00
126_V	147_Y	1.387	1.00
88_V	92_V	1.383	1.00
88_V	167_L	1.380	1.00
65_T	69_A	1.379	1.00
149_V	168_T	1.367	1.00
7_I	82_L	1.359	1.00
67_A	83_A	1.340	1.00
137_V	141_S	1.326	1.00
10_A	83_A	1.310	1.00
109_G	120_F	1.300	1.00
22_V	59_G	1.295	1.00
20_L	39_L	1.292	1.00
121_I	125_A	1.282	1.00
10_A	86_F	1.281	1.00
92_V	171_V	1.272	1.00
153_F	161_L	1.269	1.00
39_L	97_A	1.257	1.00
161_L	165_T	1.256	1.00
130_F	134_T	1.240	1.00
44_A	48_L	1.237	1.00
122_T	151_Y	1.234	1.00
23_G	44_A	1.231	1.00
42_T	137_V	1.222	1.00
6_L	10_A	1.214	1.00
127_F	137_V	1.203	1.00
71_P	79_H	1.202	1.00
26_A	52_A	1.189	1.00
130_F	140_S	1.181	1.00
145_G	171_V	1.174	1.00
142_M	179_I	1.170	1.00
23_G	29_I	1.167	1.00
23_G	48_L	1.167	1.00
108_S	171_V	1.138	1.00
130_F	139_L	1.135	1.00
11_Y	94_P	1.133	1.00
177_A	180_K	1.124	1.00
29_I	48_L	1.122	1.00
108_S	167_L	1.118	1.00
15_S	95_I	1.109	1.00
135_K	189_K	1.095	1.00
106_A	110_G	1.094	1.00
148_T	164_V	1.091	1.00
138_S	182_I	1.086	1.00
139_L	143_L	1.086	1.00
12_L	15_S	1.074	1.00
68_T	114_F	1.073	1.00
128_F	132_Y	1.065	1.00
44_A	56_V	1.064	1.00
136_F	189_K	1.063	1.00
116_A	119_L	1.052	0.99
71_P	83_A	1.042	0.99
20_L	23_G	1.040	0.99
45_F	190_V	1.038	0.99
116_A	152_S	1.035	0.99
134_T	139_L	1.021	0.99
136_F	139_L	1.004	0.99
50_V	54_S	1.001	0.99
22_V	55_V	1.001	0.99
127_F	140_S	0.999	0.99
20_L	32_R	0.999	0.99
109_G	144_T	0.995	0.99
105_V	141_S	0.991	0.99
92_V	170_F	0.989	0.99
132_Y	135_K	0.987	0.99
16_I	21_I	0.977	0.99
31_I	44_A	0.970	0.99
39_L	94_P	0.963	0.99
29_I	33_E	0.963	0.99
150_I	154_F	0.962	0.99
36_S	46_R	0.961	0.99
64_G	110_G	0.961	0.99
119_L	152_S	0.957	0.99
23_G	31_I	0.956	0.99
64_G	111_V	0.945	0.99
7_I	79_H	0.934	0.99
85_V	166_L	0.926	0.99
28_G	48_L	0.920	0.99
123_M	148_T	0.916	0.99
42_T	46_R	0.902	0.98
68_T	72_F	0.895	0.98
49_G	52_A	0.894	0.98
55_V	59_G	0.893	0.98
180_K	186_T	0.891	0.98
19_G	56_V	0.888	0.98
147_Y	151_Y	0.883	0.98
19_G	38_N	0.882	0.98
48_L	56_V	0.880	0.98
76_V	79_H	0.878	0.98
42_T	138_S	0.868	0.98
168_T	172_I	0.864	0.98
179_I	183_I	0.845	0.98
169_I	173_Y	0.827	0.97
149_V	161_L	0.819	0.97
56_V	59_G	0.811	0.97
72_F	80_P	0.807	0.97
68_T	80_P	0.807	0.97
162_I	166_L	0.806	0.97
58_A	62_L	0.804	0.97
69_A	73_L	0.803	0.97
181_R	187_E	0.801	0.97
22_V	27_K	0.785	0.96
37_G	47_T	0.783	0.96
62_L	66_L	0.779	0.96
130_F	147_Y	0.776	0.96
31_I	39_L	0.766	0.96
67_A	87_A	0.765	0.96
149_V	164_V	0.764	0.96
149_V	153_F	0.762	0.96
136_F	188_P	0.759	0.96
17_P	20_L	0.756	0.95
28_G	49_G	0.756	0.95
119_L	151_Y	0.755	0.95
24_K	30_D	0.754	0.95
48_L	52_A	0.752	0.95
88_V	104_A	0.748	0.95
108_S	144_T	0.747	0.95
33_E	37_G	0.743	0.95
140_S	144_T	0.735	0.95
45_F	54_S	0.734	0.95
22_V	26_A	0.729	0.94
161_L	164_V	0.728	0.94
81_L	163_V	0.727	0.94
118_L	121_I	0.726	0.94
113_L	120_F	0.722	0.94
68_T	71_P	0.721	0.94
159_Y	162_I	0.717	0.94
69_A	72_F	0.716	0.94
136_F	140_S	0.716	0.94
158_T	162_I	0.711	0.94
163_V	167_L	0.701	0.93
32_R	94_P	0.698	0.93
141_S	175_H	0.696	0.93
84_G	87_A	0.691	0.93
135_K	190_V	0.690	0.93
181_R	186_T	0.690	0.93
46_R	138_S	0.690	0.93
88_V	111_V	0.688	0.93
173_Y	177_A	0.683	0.92
42_T	178_N	0.678	0.92
39_L	104_A	0.677	0.92
15_S	87_A	0.677	0.92
20_L	31_I	0.675	0.92
61_I	113_L	0.672	0.92
6_L	74_M	0.671	0.92
178_N	187_E	0.667	0.91
127_F	144_T	0.666	0.91
87_A	107_T	0.663	0.91
162_I	169_I	0.657	0.91
129_I	133_L	0.654	0.91
80_P	115_Y	0.652	0.90
44_A	53_G	0.650	0.90
27_K	52_A	0.648	0.90
36_S	42_T	0.646	0.90
175_H	178_N	0.646	0.90
57_I	106_A	0.645	0.90
165_T	169_I	0.644	0.90
86_F	89_L	0.643	0.90
41_A	56_V	0.640	0.90
4_A	8_I	0.637	0.89
85_V	167_L	0.637	0.89
142_M	146_I	0.636	0.89
67_A	71_P	0.636	0.89
13_I	66_L	0.635	0.89
69_A	114_F	0.635	0.89
82_L	86_F	0.634	0.89
71_P	80_P	0.633	0.89
45_F	50_V	0.628	0.89
51_K	55_V	0.627	0.89
42_T	141_S	0.627	0.89
23_G	47_T	0.623	0.88
79_H	83_A	0.622	0.88
108_S	145_G	0.622	0.88
94_P	100_K	0.618	0.88
17_P	94_P	0.618	0.88
112_L	164_V	0.616	0.88
23_G	34_H	0.612	0.87
76_V	80_P	0.611	0.87
93_F	174_R	0.604	0.87
138_S	181_R	0.603	0.87
9_L	13_I	0.602	0.87
38_N	43_N	0.599	0.86
181_R	188_P	0.597	0.86
93_F	170_F	0.595	0.86
38_N	103_K	0.591	0.86
103_K	175_H	0.590	0.86
138_S	141_S	0.589	0.85
131_L	137_V	0.587	0.85
17_P	96_F	0.584	0.85
70_L	74_M	0.584	0.85
92_V	108_S	0.583	0.85
57_I	109_G	0.576	0.84
59_G	171_V	0.575	0.84
112_L	167_L	0.574	0.84
10_A	13_I	0.572	0.84
151_Y	155_V	0.571	0.84
23_G	27_K	0.569	0.83
127_F	131_L	0.568	0.83
46_R	178_N	0.567	0.83
31_I	47_T	0.566	0.83
44_A	52_A	0.564	0.83
146_I	169_I	0.557	0.82
150_I	158_T	0.557	0.82
152_S	161_L	0.556	0.82
12_L	96_F	0.554	0.82
64_G	68_T	0.548	0.81
145_G	168_T	0.548	0.81
43_N	103_K	0.545	0.81
23_G	26_A	0.545	0.81
105_V	138_S	0.540	0.80
13_I	64_G	0.539	0.80
46_R	141_S	0.535	0.80
54_S	58_A	0.534	0.79
94_P	108_S	0.532	0.79
139_L	182_I	0.531	0.79
138_S	187_E	0.524	0.78
19_G	31_I	0.523	0.78
89_L	170_F	0.517	0.77
36_S	178_N	0.514	0.77
131_L	135_K	0.514	0.77
77_D	80_P	0.512	0.77
36_S	138_S	0.512	0.77
153_F	165_T	0.512	0.77
157_D	160_L	0.512	0.77
80_P	83_A	0.511	0.76
54_S	57_I	0.510	0.76
93_F	173_Y	0.508	0.76
32_R	97_A	0.507	0.76
6_L	71_P	0.507	0.76
62_L	67_A	0.506	0.76
138_S	178_N	0.506	0.76
39_L	48_L	0.506	0.76
61_I	65_T	0.506	0.76
20_L	24_K	0.502	0.75
160_L	164_V	0.501	0.75
79_H	82_L	0.501	0.75
72_F	114_F	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3k3fA	3	0.9482	1.9	0.968	Contact Map
2e5zA	1	0.2902	1.9	0.968	Contact Map
4ldsA	2	0.8394	1.8	0.968	Contact Map
2bzwB	1	0.1399	1.7	0.969	Contact Map
2m0qA	1	0.3575	1.5	0.97	Contact Map
4dveA	3	0.4352	1.4	0.97	Contact Map
2gsvA	3	0.1399	1.4	0.97	Contact Map
4yypB	1	0.0881	1.4	0.97	Contact Map
3wdoA	1	0.7772	1.3	0.971	Contact Map
2voyD	1	0.1192	1.3	0.971	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.