YNEQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNEQ - Uncharacterized protein YneQ

UniProt:	Q45062	Sequences: MAFGVKREELNRWKQAVKRGEIAFLTHYWLDDRFPEAKTVTKAGCADIDKLVQWGAAYGLKKEWIHKKSEFPHFDLLGETQKYILEQENLTDHLIRFHL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	99 (97)
Sequences:	184 (150)
Seq/√Len:	15.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_V	44_G	5.219	1.00
22_I	43_A	3.612	0.99
16_A	21_E	3.592	0.99
28_Y	39_T	3.525	0.99
90_L	93_H	3.150	0.99
17_V	72_P	2.909	0.98
80_T	83_Y	2.769	0.97
55_G	64_W	2.618	0.95
61_K	64_W	2.487	0.94
9_E	96_R	2.011	0.84
48_I	52_V	1.944	0.82
55_G	58_Y	1.935	0.81
12_R	16_A	1.909	0.80
82_K	86_E	1.771	0.75
47_D	50_K	1.689	0.71
17_V	46_A	1.470	0.60
28_Y	89_N	1.458	0.59
28_Y	66_H	1.429	0.58
6_K	79_E	1.407	0.57
37_A	64_W	1.387	0.56
77_L	94_L	1.382	0.55
84_I	88_E	1.350	0.53
55_G	79_E	1.338	0.53
8_E	11_N	1.326	0.52
6_K	9_E	1.319	0.52
68_K	77_L	1.277	0.49
11_N	19_R	1.196	0.45
30_L	40_V	1.172	0.43
17_V	69_S	1.161	0.43
31_D	40_V	1.161	0.43
20_G	47_D	1.153	0.42
25_L	30_L	1.151	0.42
37_A	77_L	1.124	0.41
77_L	80_T	1.122	0.41
31_D	77_L	1.100	0.39
56_A	86_E	1.096	0.39
58_Y	87_Q	1.086	0.39
9_E	97_F	1.076	0.38
21_E	69_S	1.066	0.38
5_V	77_L	1.064	0.38
12_R	21_E	1.007	0.35
8_E	12_R	0.989	0.34
44_G	71_F	0.976	0.33
31_D	34_F	0.965	0.32
30_L	81_Q	0.948	0.32
17_V	71_F	0.945	0.31
55_G	61_K	0.930	0.31
61_K	67_K	0.929	0.31
56_A	92_D	0.920	0.30
88_E	91_T	0.913	0.30
5_V	89_N	0.908	0.30
10_L	47_D	0.907	0.30
91_T	94_L	0.892	0.29
37_A	70_E	0.886	0.29
70_E	95_I	0.882	0.28
18_K	72_P	0.874	0.28
37_A	55_G	0.872	0.28
13_W	44_G	0.847	0.27
67_K	93_H	0.840	0.27
6_K	90_L	0.835	0.26
48_I	67_K	0.834	0.26
19_R	38_K	0.832	0.26
58_Y	64_W	0.822	0.26
13_W	71_F	0.817	0.26
90_L	95_I	0.813	0.25
12_R	15_Q	0.793	0.25
15_Q	38_K	0.784	0.24
13_W	45_C	0.783	0.24
86_E	94_L	0.770	0.24
28_Y	67_K	0.770	0.24
89_N	94_L	0.768	0.24
92_D	97_F	0.764	0.23
6_K	82_K	0.761	0.23
10_L	50_K	0.761	0.23
11_N	37_A	0.758	0.23
12_R	92_D	0.755	0.23
6_K	36_E	0.753	0.23
82_K	90_L	0.752	0.23
23_A	65_I	0.749	0.23
7_R	11_N	0.747	0.23
66_H	85_L	0.741	0.22
8_E	95_I	0.739	0.22
55_G	66_H	0.730	0.22
16_A	19_R	0.730	0.22
81_Q	93_H	0.725	0.22
15_Q	19_R	0.723	0.22
19_R	25_L	0.720	0.22
82_K	91_T	0.716	0.21
56_A	74_F	0.711	0.21
56_A	62_K	0.708	0.21
52_V	67_K	0.696	0.21
19_R	47_D	0.695	0.21
93_H	97_F	0.689	0.20
18_K	70_E	0.685	0.20
24_F	55_G	0.663	0.20
15_Q	66_H	0.661	0.19
50_K	79_E	0.661	0.19
53_Q	56_A	0.653	0.19
13_W	24_F	0.650	0.19
80_T	97_F	0.643	0.19
39_T	59_G	0.628	0.18
11_N	82_K	0.623	0.18
62_K	72_P	0.622	0.18
62_K	70_E	0.620	0.18
22_I	93_H	0.620	0.18
60_L	64_W	0.617	0.18
49_D	91_T	0.614	0.18
38_K	96_R	0.611	0.18
52_V	56_A	0.611	0.18
57_A	66_H	0.609	0.18
16_A	50_K	0.609	0.18
10_L	81_Q	0.606	0.18
63_E	96_R	0.602	0.17
6_K	49_D	0.602	0.17
53_Q	59_G	0.595	0.17
49_D	53_Q	0.595	0.17
52_V	71_F	0.588	0.17
37_A	61_K	0.583	0.17
5_V	82_K	0.583	0.17
62_K	82_K	0.581	0.17
25_L	92_D	0.579	0.17
46_A	81_Q	0.579	0.17
28_Y	38_K	0.573	0.17
25_L	93_H	0.573	0.17
94_L	97_F	0.573	0.17
10_L	72_P	0.564	0.16
30_L	48_I	0.564	0.16
43_A	50_K	0.560	0.16
72_P	97_F	0.560	0.16
22_I	63_E	0.556	0.16
67_K	82_K	0.554	0.16
49_D	86_E	0.549	0.16
9_E	84_I	0.549	0.16
58_Y	80_T	0.545	0.16
15_Q	86_E	0.536	0.15
11_N	71_F	0.534	0.15
56_A	89_N	0.529	0.15
18_K	97_F	0.520	0.15
90_L	97_F	0.518	0.15
49_D	71_F	0.516	0.15
32_D	48_I	0.516	0.15
15_Q	82_K	0.514	0.15
5_V	52_V	0.512	0.15
13_W	17_V	0.508	0.15
18_K	79_E	0.501	0.14
71_F	95_I	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jrtA	1	0.3434	22.7	0.945	Contact Map
2qjzA	1	0.8182	19.7	0.947	Contact Map
3ayvA	2	0.8485	13	0.95	Contact Map
1wyoA	1	0.8384	9.4	0.954	Contact Map
1qzpA	1	0.2525	8.9	0.954	Contact Map
1yu8X	1	0.2525	8.7	0.954	Contact Map
2k6mS	1	0.2525	8.4	0.955	Contact Map
3ddeA	3	0.8889	8.4	0.955	Contact Map
1rw1A	1	0.6465	8.1	0.955	Contact Map
4xrpC	1	0.5859	7.7	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.