YNEA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNEA - Cell division suppressor protein YneA

UniProt:	Q45056	Sequences: MIMSKESIIFVGLFTVILSAVILMLSYTSSGQELNQYVKIEVQQGDTLWSIADQVADTKKINKNDFIEWVADKNQLQTSDIQPGDELVIPLKKKHQDAYELATVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	105 (81)
Sequences:	222 (209)
Seq/√Len:	23.2

BACSU - YNEA YQFZ SAFA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_I	46_D	5.958	1.00
40_I	55_V	4.548	1.00
32_Q	81_I	2.320	0.97
44_Q	52_A	2.199	0.96
48_L	87_L	2.030	0.94
73_K	90_P	1.845	0.91
58_T	67_I	1.767	0.89
55_V	89_I	1.700	0.87
40_I	54_Q	1.640	0.85
48_L	73_K	1.625	0.84
14_F	27_Y	1.607	0.83
48_L	67_I	1.538	0.80
37_Y	48_L	1.475	0.78
42_V	87_L	1.455	0.77
70_V	87_L	1.453	0.76
47_T	50_S	1.429	0.75
29_S	89_I	1.420	0.75
67_I	71_A	1.409	0.74
39_K	86_E	1.388	0.73
48_L	71_A	1.373	0.72
17_I	98_A	1.334	0.70
58_T	68_E	1.318	0.69
45_G	83_P	1.261	0.66
19_S	56_A	1.256	0.65
30_S	56_A	1.248	0.65
13_L	98_A	1.227	0.63
49_W	52_A	1.209	0.62
15_T	21_V	1.209	0.62
49_W	68_E	1.187	0.61
76_L	85_D	1.178	0.60
18_L	23_L	1.147	0.58
22_I	99_Y	1.109	0.55
15_T	89_I	1.100	0.55
81_I	86_E	1.089	0.54
12_G	47_T	1.087	0.54
21_V	36_Q	1.083	0.54
41_E	45_G	1.082	0.54
52_A	57_D	1.081	0.53
17_I	24_M	1.074	0.53
47_T	53_D	1.059	0.52
32_Q	96_Q	1.041	0.51
22_I	34_L	1.024	0.50
94_K	98_A	1.016	0.49
29_S	36_Q	1.003	0.48
34_L	51_I	0.988	0.47
56_A	92_K	0.986	0.47
37_Y	40_I	0.974	0.46
70_V	76_L	0.958	0.45
37_Y	46_D	0.941	0.44
57_D	67_I	0.900	0.41
73_K	88_V	0.890	0.40
52_A	72_D	0.886	0.40
46_D	72_D	0.885	0.40
39_K	88_V	0.882	0.40
75_Q	80_D	0.879	0.40
78_T	93_K	0.864	0.39
34_L	38_V	0.861	0.38
26_S	35_N	0.842	0.37
77_Q	87_L	0.831	0.36
57_D	68_E	0.815	0.35
43_Q	46_D	0.811	0.35
41_E	86_E	0.797	0.34
41_E	84_G	0.794	0.34
22_I	25_L	0.793	0.34
40_I	50_S	0.788	0.34
58_T	78_T	0.788	0.34
33_E	42_V	0.783	0.33
36_Q	73_K	0.777	0.33
11_V	83_P	0.774	0.33
42_V	48_L	0.773	0.33
20_A	36_Q	0.773	0.33
46_D	77_Q	0.769	0.32
27_Y	30_S	0.762	0.32
57_D	92_K	0.762	0.32
25_L	29_S	0.761	0.32
39_K	89_I	0.751	0.31
48_L	76_L	0.737	0.31
38_V	58_T	0.729	0.30
72_D	93_K	0.727	0.30
33_E	52_A	0.720	0.30
38_V	91_L	0.699	0.28
43_Q	83_P	0.695	0.28
25_L	28_T	0.689	0.28
37_Y	90_P	0.678	0.27
45_G	53_D	0.664	0.26
16_V	92_K	0.663	0.26
13_L	23_L	0.663	0.26
17_I	21_V	0.656	0.26
49_W	87_L	0.654	0.26
14_F	98_A	0.642	0.25
52_A	87_L	0.641	0.25
35_N	52_A	0.641	0.25
57_D	71_A	0.634	0.25
17_I	95_H	0.634	0.25
72_D	75_Q	0.619	0.24
67_I	81_I	0.619	0.24
70_V	94_K	0.605	0.23
44_Q	51_I	0.601	0.23
58_T	96_Q	0.595	0.23
57_D	70_V	0.587	0.22
26_S	54_Q	0.580	0.22
14_F	44_Q	0.565	0.21
31_G	40_I	0.556	0.21
22_I	95_H	0.550	0.21
52_A	71_A	0.550	0.21
81_I	84_G	0.546	0.20
32_Q	50_S	0.545	0.20
39_K	70_V	0.544	0.20
48_L	88_V	0.541	0.20
57_D	73_K	0.540	0.20
33_E	69_W	0.538	0.20
93_K	99_Y	0.535	0.20
27_Y	79_S	0.533	0.20
15_T	28_T	0.532	0.20
33_E	78_T	0.529	0.20
38_V	54_Q	0.525	0.20
27_Y	47_T	0.525	0.20
50_S	84_G	0.516	0.19
38_V	76_L	0.510	0.19
14_F	20_A	0.507	0.19
36_Q	89_I	0.500	0.18
73_K	89_I	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4b8vA	2	0.6286	99.4	0.492	Contact Map
2mkxA	1	0.4857	99.3	0.518	Contact Map
2djpA	1	0.7143	99.2	0.528	Contact Map
4xcmA	2	0.5143	99.2	0.537	Contact Map
2mpwA	1	0.8	99.1	0.547	Contact Map
1e0gA	1	0.4571	99.1	0.551	Contact Map
4pxvA	1	0.4476	99.1	0.559	Contact Map
4uz3A	1	0.6952	99.1	0.561	Contact Map
4a1kA	2	0.5905	99	0.567	Contact Map
2l9yA	1	0.8952	99	0.567	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.