YCXB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YCXB - Uncharacterized protein YcxB

UniProt:	Q08793	Sequences: MIQYASESINLPGEITFKDVREIFFYQIAKISCFYFLLFCAIFAAVNFINGWPRIVYGSDALNLFMNSMLIIVMSVLFTLLLLLLLYVKFSRAYKKNERMKSKRTYTLNQEGIRICSKKYDLIFNWDEITAVFEYKNIFRVNTSSGQYIAIPKHFFHSEEEMNRFKEIILKNTETKKLKFKKDQH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	185 (158)
Sequences:	238 (219)
Seq/√Len:	17.4

BACSU - YCXB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_Q	142_N	4.377	1.00
134_E	153_K	3.824	1.00
12_P	105_T	3.724	1.00
23_I	148_Y	2.776	0.98
19_D	154_H	2.621	0.97
10_N	105_T	2.543	0.96
114_R	123_I	2.467	0.96
134_E	139_F	2.457	0.95
29_A	34_F	2.214	0.92
39_F	45_A	2.182	0.91
64_L	73_V	2.144	0.91
139_F	153_K	2.074	0.89
154_H	165_F	2.071	0.89
142_N	152_P	2.046	0.89
13_G	106_Y	2.032	0.88
10_N	107_T	2.031	0.88
12_P	103_K	1.961	0.86
19_D	141_V	1.882	0.84
18_K	87_Y	1.860	0.83
111_E	144_S	1.837	0.82
73_V	132_V	1.802	0.81
15_I	100_M	1.722	0.78
165_F	169_I	1.719	0.78
23_I	122_L	1.657	0.75
27_Q	93_A	1.604	0.73
9_I	165_F	1.570	0.71
33_C	113_I	1.566	0.71
73_V	150_A	1.555	0.70
40_C	135_Y	1.539	0.69
22_E	138_I	1.539	0.69
26_Y	30_K	1.527	0.69
11_L	150_A	1.513	0.68
132_V	173_T	1.506	0.68
32_S	36_F	1.445	0.64
104_R	115_I	1.410	0.62
139_F	162_M	1.403	0.62
15_I	123_I	1.391	0.61
23_I	171_K	1.371	0.60
9_I	76_V	1.335	0.58
108_L	125_N	1.333	0.58
95_K	161_E	1.332	0.58
91_S	95_K	1.314	0.57
152_P	172_N	1.305	0.56
129_I	170_L	1.294	0.56
139_F	165_F	1.290	0.55
69_M	80_L	1.286	0.55
39_F	49_I	1.283	0.55
77_L	89_K	1.270	0.54
21_R	94_Y	1.263	0.54
42_I	167_E	1.255	0.53
113_I	127_D	1.242	0.53
89_K	93_A	1.241	0.52
24_F	149_I	1.217	0.51
26_Y	164_R	1.211	0.51
22_E	137_N	1.201	0.50
75_S	105_T	1.198	0.50
25_F	28_I	1.189	0.49
108_L	169_I	1.184	0.49
141_V	151_I	1.179	0.49
160_E	170_L	1.166	0.48
80_L	105_T	1.155	0.47
44_A	80_L	1.149	0.47
24_F	81_L	1.147	0.47
34_F	93_A	1.135	0.46
71_I	99_R	1.125	0.45
42_I	69_M	1.119	0.45
20_V	94_Y	1.117	0.45
112_G	172_N	1.114	0.45
49_I	75_S	1.114	0.45
103_K	117_S	1.095	0.44
29_A	36_F	1.086	0.43
42_I	127_D	1.082	0.43
11_L	108_L	1.080	0.43
158_S	162_M	1.077	0.43
14_E	103_K	1.077	0.43
24_F	140_R	1.068	0.42
29_A	83_L	1.068	0.42
153_K	160_E	1.061	0.42
85_L	160_E	1.051	0.41
20_V	29_A	1.044	0.41
100_M	103_K	1.042	0.41
20_V	46_V	1.040	0.40
110_Q	171_K	1.004	0.38
105_T	124_F	0.996	0.38
142_N	148_Y	0.984	0.37
97_N	143_T	0.976	0.37
139_F	159_E	0.973	0.37
65_F	153_K	0.968	0.36
19_D	168_I	0.958	0.36
83_L	159_E	0.957	0.36
107_T	160_E	0.953	0.35
73_V	143_T	0.948	0.35
15_I	19_D	0.947	0.35
125_N	163_N	0.946	0.35
108_L	113_I	0.935	0.34
16_T	91_S	0.935	0.34
16_T	159_E	0.931	0.34
45_A	139_F	0.929	0.34
78_F	115_I	0.923	0.34
103_K	112_G	0.922	0.34
72_I	172_N	0.907	0.33
11_L	173_T	0.907	0.33
126_W	152_P	0.906	0.33
125_N	128_E	0.903	0.33
92_R	96_K	0.899	0.33
161_E	164_R	0.893	0.32
26_Y	40_C	0.891	0.32
132_V	167_E	0.889	0.32
76_V	95_K	0.873	0.31
74_M	122_L	0.873	0.31
49_I	80_L	0.869	0.31
144_S	165_F	0.869	0.31
153_K	162_M	0.866	0.31
74_M	111_E	0.845	0.30
165_F	168_I	0.843	0.30
96_K	135_Y	0.841	0.30
41_A	136_K	0.839	0.29
154_H	157_H	0.839	0.29
37_L	149_I	0.839	0.29
16_T	19_D	0.835	0.29
28_I	77_L	0.830	0.29
32_S	72_I	0.826	0.29
46_V	145_S	0.825	0.29
140_R	158_S	0.823	0.29
134_E	166_K	0.816	0.28
41_A	79_T	0.805	0.28
41_A	142_N	0.803	0.28
70_L	91_S	0.776	0.26
9_I	15_I	0.774	0.26
46_V	107_T	0.772	0.26
138_I	151_I	0.770	0.26
42_I	68_S	0.769	0.26
19_D	22_E	0.768	0.26
132_V	149_I	0.765	0.26
34_F	86_L	0.760	0.26
45_A	170_L	0.754	0.25
80_L	101_K	0.750	0.25
108_L	143_T	0.746	0.25
24_F	151_I	0.745	0.25
86_L	174_E	0.742	0.25
143_T	147_Q	0.742	0.25
11_L	115_I	0.736	0.25
117_S	128_E	0.734	0.24
14_E	73_V	0.733	0.24
37_L	41_A	0.729	0.24
44_A	117_S	0.722	0.24
97_N	102_S	0.721	0.24
25_F	119_K	0.713	0.23
23_I	86_L	0.706	0.23
101_K	106_Y	0.702	0.23
38_L	153_K	0.700	0.23
73_V	133_F	0.700	0.23
117_S	127_D	0.695	0.23
19_D	24_F	0.693	0.23
158_S	165_F	0.687	0.22
167_E	171_K	0.682	0.22
98_E	124_F	0.681	0.22
19_D	100_M	0.679	0.22
49_I	73_V	0.674	0.22
82_L	151_I	0.672	0.22
110_Q	125_N	0.670	0.22
31_I	34_F	0.670	0.22
139_F	166_K	0.666	0.22
110_Q	121_D	0.663	0.21
39_F	141_V	0.659	0.21
32_S	160_E	0.648	0.21
40_C	113_I	0.647	0.21
75_S	81_L	0.642	0.21
113_I	118_K	0.641	0.21
105_T	121_D	0.640	0.20
36_F	170_L	0.632	0.20
140_R	159_E	0.625	0.20
43_F	108_L	0.625	0.20
88_V	130_T	0.621	0.20
132_V	174_E	0.615	0.20
23_I	152_P	0.613	0.19
35_Y	42_I	0.613	0.19
12_P	90_F	0.610	0.19
163_N	175_T	0.606	0.19
40_C	165_F	0.604	0.19
77_L	118_K	0.603	0.19
40_C	161_E	0.601	0.19
78_F	89_K	0.600	0.19
141_V	159_E	0.594	0.19
91_S	115_I	0.593	0.19
11_L	104_R	0.592	0.19
15_I	172_N	0.586	0.18
19_D	161_E	0.586	0.18
15_I	171_K	0.585	0.18
28_I	45_A	0.584	0.18
38_L	43_F	0.583	0.18
149_I	176_K	0.582	0.18
21_R	82_L	0.582	0.18
88_V	163_N	0.578	0.18
124_F	169_I	0.578	0.18
112_G	151_I	0.577	0.18
13_G	83_L	0.574	0.18
16_T	170_L	0.573	0.18
88_V	127_D	0.566	0.18
38_L	160_E	0.564	0.18
58_G	91_S	0.561	0.18
24_F	100_M	0.560	0.17
25_F	92_R	0.559	0.17
99_R	146_G	0.559	0.17
86_L	104_R	0.556	0.17
168_I	172_N	0.555	0.17
17_F	90_F	0.555	0.17
117_S	120_Y	0.555	0.17
16_T	141_V	0.553	0.17
41_A	138_I	0.553	0.17
134_E	162_M	0.550	0.17
97_N	144_S	0.548	0.17
48_F	89_K	0.548	0.17
92_R	163_N	0.546	0.17
108_L	121_D	0.545	0.17
135_Y	138_I	0.544	0.17
129_I	176_K	0.541	0.17
40_C	138_I	0.539	0.17
87_Y	94_Y	0.530	0.16
48_F	109_N	0.530	0.16
13_G	152_P	0.525	0.16
121_D	161_E	0.521	0.16
48_F	70_L	0.521	0.16
69_M	163_N	0.520	0.16
34_F	117_S	0.519	0.16
108_L	165_F	0.516	0.16
23_I	27_Q	0.516	0.16
131_A	139_F	0.515	0.16
95_K	125_N	0.511	0.16
98_E	166_K	0.508	0.16
111_E	137_N	0.507	0.16
80_L	140_R	0.507	0.16
90_F	145_S	0.505	0.16
16_T	69_M	0.504	0.16
77_L	113_I	0.502	0.16
75_S	151_I	0.501	0.16
21_R	147_Q	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4chmA	1	0.5946	12.8	0.941	Contact Map
4qiwN	1	0.2	12	0.941	Contact Map
1twfJ	1	0.2	10.3	0.943	Contact Map
2rddB	1	0.2	9.7	0.944	Contact Map
4chjA	1	0.5784	7.6	0.946	Contact Map
1pfjA	1	0.5189	7.6	0.946	Contact Map
4aybN	1	0.2	6	0.949	Contact Map
4khbD	1	0.5081	4.8	0.951	Contact Map
4fvmA	1	0.3459	4.7	0.951	Contact Map
2pofA	1	0.4378	4.2	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.