KAPB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

KAPB - Kinase-associated lipoprotein B

UniProt:	Q08429	Sequences: MSTFETGSIVKGFYKTGVYIGEITACRPQHYLVKVKAVLTHPAQGDLHHPKQADVPFFHERKALAYGEQTNIPHHMVKPYDGEVPDYTESLREATAQMRAKLNEDGSEWAKRSLHNLDILEKEYFNRP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	128 (118)
Sequences:	156 (130)
Seq/√Len:	12.0

BACSU - KAPB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_E	34_K	6.249	1.00
24_T	69_Q	3.472	0.98
99_R	121_E	3.261	0.97
11_K	18_V	2.734	0.93
30_H	69_Q	2.331	0.85
37_A	85_P	2.228	0.82
31_Y	74_H	2.110	0.79
92_R	96_A	2.091	0.78
60_E	119_I	2.019	0.75
62_K	123_E	1.931	0.72
31_Y	71_N	1.906	0.71
112_R	115_H	1.778	0.65
107_S	110_A	1.756	0.64
13_F	18_V	1.670	0.60
60_E	116_N	1.669	0.60
34_K	67_G	1.640	0.59
62_K	109_W	1.638	0.59
69_Q	76_M	1.632	0.58
8_S	80_Y	1.594	0.57
101_K	122_K	1.589	0.56
20_I	39_L	1.559	0.55
24_T	31_Y	1.547	0.54
12_G	36_K	1.544	0.54
119_I	123_E	1.536	0.54
14_Y	70_T	1.530	0.53
53_A	106_G	1.524	0.53
53_A	57_F	1.510	0.52
16_T	123_E	1.495	0.52
62_K	98_M	1.477	0.51
36_K	67_G	1.450	0.49
32_L	71_N	1.405	0.47
26_C	74_H	1.387	0.46
21_G	70_T	1.378	0.46
22_E	36_K	1.371	0.45
9_I	80_Y	1.364	0.45
51_K	109_W	1.345	0.44
93_E	111_K	1.342	0.44
41_H	124_Y	1.284	0.41
29_Q	49_H	1.273	0.41
30_H	60_E	1.272	0.41
32_L	51_K	1.241	0.39
24_T	71_N	1.236	0.39
57_F	98_M	1.229	0.38
25_A	65_A	1.227	0.38
72_I	121_E	1.192	0.37
35_V	84_V	1.176	0.36
24_T	76_M	1.164	0.35
23_I	71_N	1.161	0.35
53_A	108_E	1.155	0.35
43_A	96_A	1.151	0.35
119_I	122_K	1.115	0.33
10_V	14_Y	1.106	0.33
60_E	72_I	1.103	0.33
54_D	97_Q	1.089	0.32
104_E	115_H	1.075	0.31
13_F	62_K	1.071	0.31
40_T	118_D	1.050	0.30
18_V	27_R	1.016	0.29
36_K	85_P	1.010	0.29
12_G	70_T	1.002	0.28
103_N	118_D	0.990	0.28
95_T	110_A	0.990	0.28
14_Y	21_G	0.968	0.27
88_T	122_K	0.965	0.27
53_A	105_D	0.963	0.27
100_A	122_K	0.951	0.26
80_Y	93_E	0.949	0.26
116_N	120_L	0.931	0.26
103_N	106_G	0.922	0.25
16_T	76_M	0.913	0.25
21_G	71_N	0.904	0.25
86_D	89_E	0.894	0.24
28_P	69_Q	0.893	0.24
86_D	93_E	0.883	0.24
33_V	97_Q	0.880	0.24
55_V	73_P	0.880	0.24
20_I	84_V	0.878	0.24
27_R	71_N	0.869	0.23
32_L	69_Q	0.856	0.23
20_I	80_Y	0.854	0.23
86_D	107_S	0.843	0.22
41_H	91_L	0.838	0.22
39_L	60_E	0.832	0.22
86_D	101_K	0.828	0.22
92_R	107_S	0.826	0.22
33_V	76_M	0.824	0.22
52_Q	108_E	0.819	0.22
95_T	107_S	0.814	0.21
12_G	62_K	0.807	0.21
13_F	73_P	0.807	0.21
55_V	110_A	0.796	0.21
33_V	110_A	0.786	0.20
83_E	112_R	0.760	0.20
30_H	71_N	0.757	0.19
24_T	30_H	0.746	0.19
51_K	113_S	0.738	0.19
28_P	114_L	0.727	0.19
12_G	43_A	0.723	0.18
60_E	105_D	0.722	0.18
95_T	99_R	0.721	0.18
95_T	119_I	0.716	0.18
83_E	108_E	0.710	0.18
40_T	43_A	0.708	0.18
34_K	69_Q	0.703	0.18
106_G	109_W	0.699	0.18
62_K	120_L	0.695	0.18
78_K	82_G	0.692	0.18
105_D	116_N	0.684	0.17
65_A	71_N	0.681	0.17
22_E	118_D	0.679	0.17
16_T	73_P	0.676	0.17
111_K	118_D	0.665	0.17
86_D	122_K	0.660	0.17
49_H	122_K	0.655	0.16
98_M	116_N	0.652	0.16
98_M	109_W	0.650	0.16
65_A	69_Q	0.648	0.16
53_A	107_S	0.647	0.16
20_I	123_E	0.646	0.16
34_K	98_M	0.645	0.16
40_T	79_P	0.643	0.16
16_T	67_G	0.642	0.16
89_E	111_K	0.639	0.16
99_R	104_E	0.636	0.16
108_E	115_H	0.635	0.16
108_E	112_R	0.633	0.16
20_I	37_A	0.629	0.16
84_V	89_E	0.628	0.16
40_T	96_A	0.626	0.16
41_H	62_K	0.623	0.16
27_R	109_W	0.622	0.16
54_D	110_A	0.621	0.16
92_R	100_A	0.621	0.16
79_P	88_T	0.619	0.16
13_F	76_M	0.613	0.15
35_V	50_P	0.612	0.15
66_Y	81_D	0.612	0.15
109_W	113_S	0.610	0.15
81_D	104_E	0.610	0.15
110_A	123_E	0.609	0.15
65_A	100_A	0.609	0.15
81_D	112_R	0.607	0.15
108_E	111_K	0.605	0.15
20_I	82_G	0.604	0.15
43_A	123_E	0.602	0.15
72_I	107_S	0.597	0.15
88_T	118_D	0.595	0.15
39_L	89_E	0.593	0.15
33_V	66_Y	0.589	0.15
9_I	20_I	0.589	0.15
24_T	55_V	0.578	0.14
28_P	53_A	0.575	0.14
36_K	62_K	0.575	0.14
32_L	99_R	0.575	0.14
9_I	84_V	0.572	0.14
76_M	113_S	0.571	0.14
89_E	117_L	0.570	0.14
79_P	103_N	0.553	0.14
81_D	103_N	0.551	0.14
21_G	41_H	0.550	0.14
99_R	114_L	0.549	0.14
91_L	124_Y	0.546	0.14
29_Q	116_N	0.543	0.14
18_V	55_V	0.539	0.14
79_P	118_D	0.539	0.14
39_L	106_G	0.531	0.13
49_H	106_G	0.522	0.13
43_A	97_Q	0.522	0.13
20_I	115_H	0.515	0.13
20_I	65_A	0.510	0.13
74_H	121_E	0.508	0.13
31_Y	77_V	0.507	0.13
84_V	96_A	0.506	0.13
34_K	108_E	0.503	0.13
60_E	67_G	0.503	0.13
8_S	57_F	0.500	0.13
36_K	43_A	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y71A	2	0.875	100	0.091	Contact Map
3qbyA	3	0.6719	85.9	0.921	Contact Map
4n4gA	1	0.6719	82.7	0.924	Contact Map
4z02A	1	0.75	82.6	0.924	Contact Map
4qw2A	1	0.8438	80	0.927	Contact Map
4ld6A	1	0.7812	79.4	0.927	Contact Map
3h8zA	1	0.4219	78.5	0.928	Contact Map
3pfsA	1	0.7891	78	0.928	Contact Map
1ri0A	1	0.7188	77.6	0.928	Contact Map
3l42A	1	0.8047	73.8	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.