COTY - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COTY - Spore coat protein Y

UniProt:	Q08311	Sequences: MSCGKTHGRHENCVCDAVEKILAEQEAVEEQCPTGCYTNLLNPTIAGKDTIPFLVFDKKGGLFSTFGNVGGFVDDMQCFESIFFRVEKLCDCCATLSILRPVDVKGDTLSVCHPCDPDFFGLEKTDFCIEVDLGCFCAIQCLSPELVDRTSPHKDKKHHHNG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	162 (144)
Sequences:	133 (99)
Seq/√Len:	8.2

BACSU - COTY COTZ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_C	92_C	8.667	1.00
53_F	139_I	3.484	0.94
57_D	60_G	3.418	0.94
18_V	139_I	3.056	0.89
52_P	142_L	2.949	0.87
87_E	97_S	2.946	0.87
32_C	36_C	2.498	0.77
51_I	144_P	2.442	0.75
18_V	60_G	2.281	0.69
18_V	53_F	2.209	0.67
97_S	126_D	2.151	0.65
89_L	94_A	2.150	0.65
86_V	94_A	2.148	0.65
22_L	26_E	2.106	0.63
122_L	142_L	2.014	0.59
26_E	30_E	1.781	0.50
86_V	89_L	1.776	0.50
39_N	144_P	1.732	0.48
52_P	122_L	1.658	0.45
65_T	84_F	1.564	0.41
54_L	62_L	1.537	0.40
14_V	138_A	1.521	0.39
62_L	66_F	1.513	0.39
98_I	144_P	1.509	0.39
19_E	90_C	1.489	0.38
51_I	98_I	1.464	0.37
2_S	5_K	1.446	0.36
49_D	86_V	1.446	0.36
59_K	62_L	1.446	0.36
6_T	125_T	1.442	0.36
54_L	142_L	1.419	0.35
90_C	135_C	1.368	0.33
18_V	57_D	1.364	0.33
51_I	97_S	1.363	0.33
97_S	144_P	1.361	0.33
52_P	67_G	1.353	0.33
64_S	82_I	1.344	0.32
32_C	35_G	1.335	0.32
24_E	97_S	1.328	0.32
87_E	126_D	1.312	0.31
101_P	143_S	1.298	0.31
97_S	127_F	1.292	0.31
90_C	137_C	1.287	0.30
17_A	97_S	1.259	0.29
80_E	139_I	1.250	0.29
94_A	147_V	1.237	0.29
77_Q	134_G	1.196	0.27
84_F	96_L	1.171	0.26
20_K	24_E	1.170	0.26
81_S	98_I	1.169	0.26
60_G	97_S	1.154	0.26
78_C	119_F	1.138	0.25
28_V	35_G	1.112	0.25
41_L	87_E	1.104	0.24
46_A	56_F	1.100	0.24
35_G	98_I	1.087	0.24
56_F	129_I	1.080	0.24
40_L	122_L	1.074	0.23
20_K	81_S	1.064	0.23
18_V	92_C	1.057	0.23
17_A	130_E	1.052	0.23
36_C	93_C	1.049	0.23
14_V	40_L	1.038	0.22
28_V	40_L	1.036	0.22
35_G	40_L	1.033	0.22
67_G	98_I	1.014	0.22
85_R	124_K	0.995	0.21
43_P	65_T	0.992	0.21
122_L	131_V	0.987	0.21
40_L	52_P	0.986	0.21
16_D	58_K	0.985	0.21
31_Q	88_K	0.977	0.21
112_C	139_I	0.973	0.21
41_L	131_V	0.972	0.21
2_S	8_G	0.969	0.20
12_N	100_R	0.968	0.20
52_P	98_I	0.957	0.20
39_N	88_K	0.951	0.20
134_G	139_I	0.943	0.20
54_L	64_S	0.942	0.20
94_A	136_F	0.938	0.20
51_I	67_G	0.935	0.20
57_D	127_F	0.926	0.19
59_K	110_S	0.926	0.19
24_E	65_T	0.915	0.19
25_Q	50_T	0.904	0.19
65_T	128_C	0.902	0.19
51_I	87_E	0.883	0.18
12_N	91_D	0.874	0.18
19_E	104_V	0.872	0.18
65_T	98_I	0.870	0.18
49_D	95_T	0.866	0.18
42_N	129_I	0.865	0.18
43_P	116_D	0.863	0.18
56_F	142_L	0.857	0.18
111_V	145_E	0.854	0.17
19_E	23_A	0.852	0.17
30_E	134_G	0.846	0.17
39_N	49_D	0.831	0.17
96_L	131_V	0.828	0.17
53_F	78_C	0.826	0.17
67_G	144_P	0.826	0.17
13_C	141_C	0.823	0.17
81_S	87_E	0.813	0.17
48_K	67_G	0.805	0.16
12_N	19_E	0.803	0.16
11_E	107_D	0.797	0.16
101_P	140_Q	0.797	0.16
84_F	131_V	0.786	0.16
79_F	105_K	0.782	0.16
17_A	145_E	0.782	0.16
60_G	87_E	0.778	0.16
67_G	97_S	0.774	0.16
28_V	78_C	0.772	0.16
27_A	139_I	0.772	0.16
126_D	140_Q	0.769	0.16
97_S	140_Q	0.768	0.16
5_K	74_D	0.763	0.15
53_F	60_G	0.758	0.15
61_G	66_F	0.756	0.15
52_P	99_L	0.756	0.15
18_V	54_L	0.755	0.15
20_K	147_V	0.752	0.15
14_V	122_L	0.738	0.15
98_I	142_L	0.735	0.15
17_A	138_A	0.730	0.15
57_D	97_S	0.729	0.15
103_D	106_G	0.727	0.15
28_V	51_I	0.726	0.15
2_S	113_H	0.726	0.15
25_Q	63_F	0.725	0.15
23_A	121_G	0.716	0.14
50_T	63_F	0.713	0.14
83_F	112_C	0.711	0.14
2_S	66_F	0.711	0.14
15_C	86_V	0.710	0.14
79_F	124_K	0.707	0.14
7_H	15_C	0.688	0.14
24_E	143_S	0.681	0.14
64_S	110_S	0.677	0.14
21_I	129_I	0.673	0.14
65_T	147_V	0.668	0.13
60_G	127_F	0.664	0.13
13_C	93_C	0.656	0.13
48_K	143_S	0.653	0.13
81_S	118_D	0.652	0.13
24_E	52_P	0.651	0.13
16_D	124_K	0.647	0.13
82_I	114_P	0.647	0.13
100_R	145_E	0.645	0.13
93_C	141_C	0.629	0.13
41_L	50_T	0.628	0.13
24_E	98_I	0.627	0.13
16_D	39_N	0.626	0.13
54_L	122_L	0.623	0.13
111_V	140_Q	0.622	0.13
56_F	125_T	0.620	0.13
13_C	128_C	0.617	0.13
78_C	112_C	0.616	0.12
58_K	77_Q	0.613	0.12
19_E	37_Y	0.612	0.12
114_P	145_E	0.611	0.12
24_E	144_P	0.611	0.12
82_I	101_P	0.607	0.12
102_V	106_G	0.606	0.12
87_E	124_K	0.601	0.12
58_K	128_C	0.595	0.12
49_D	112_C	0.594	0.12
25_Q	85_R	0.591	0.12
111_V	114_P	0.591	0.12
24_E	57_D	0.590	0.12
60_G	147_V	0.589	0.12
9_R	105_K	0.587	0.12
83_F	121_G	0.584	0.12
21_I	25_Q	0.582	0.12
22_L	89_L	0.580	0.12
7_H	11_E	0.576	0.12
24_E	39_N	0.575	0.12
61_G	102_V	0.570	0.12
20_K	39_N	0.565	0.12
24_E	126_D	0.564	0.12
139_I	146_L	0.563	0.12
49_D	94_A	0.561	0.12
28_V	98_I	0.557	0.11
65_T	81_S	0.551	0.11
12_N	134_G	0.550	0.11
63_F	85_R	0.549	0.11
14_V	140_Q	0.546	0.11
83_F	139_I	0.544	0.11
21_I	50_T	0.543	0.11
55_V	136_F	0.542	0.11
15_C	18_V	0.540	0.11
5_K	12_N	0.537	0.11
39_N	51_I	0.537	0.11
59_K	92_C	0.536	0.11
21_I	139_I	0.536	0.11
97_S	143_S	0.535	0.11
70_G	111_V	0.534	0.11
93_C	132_D	0.534	0.11
40_L	142_L	0.533	0.11
67_G	127_F	0.524	0.11
120_F	143_S	0.524	0.11
69_V	91_D	0.524	0.11
86_V	95_T	0.523	0.11
16_D	77_Q	0.521	0.11
22_L	53_F	0.520	0.11
67_G	126_D	0.519	0.11
31_Q	118_D	0.517	0.11
125_T	139_I	0.515	0.11
50_T	85_R	0.515	0.11
59_K	120_F	0.512	0.11
49_D	61_G	0.508	0.11
93_C	137_C	0.508	0.11
17_A	108_T	0.503	0.11
60_G	98_I	0.501	0.11
94_A	133_L	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rjuV	1	0.2222	2.7	0.97	Contact Map
2l9zA	1	0.2407	2.2	0.971	Contact Map
4ux8A	1	0.1481	2	0.971	Contact Map
1fu9A	1	0.216	1.6	0.973	Contact Map
2v2fA	1	0.0926	1.6	0.973	Contact Map
2h85A	4	0.3765	1.4	0.974	Contact Map
2jysA	1	0.2778	1.3	0.974	Contact Map
4dvkA	1	0.4568	1.2	0.975	Contact Map
2xeuA	2	0.2407	1	0.976	Contact Map
1g92A	1	0.0864	1	0.977	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.