FTSL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FTSL - Cell division protein FtsL

UniProt:	Q07867	Sequences: MSNLAYQPEKQQRHAISPEKKVIVKKRASITLGEKVLLVLFAAAVLSVSLLIVSKAYAAYQTNIEVQKLEEQISSENKQIGDLEKSVADLSKPQRIMDIAKKNGLNLKDKKVKNIQE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	117 (111)
Sequences:	185 (155)
Seq/√Len:	14.7

BACSU - FTSL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
76_E	80_I	3.488	0.99
93_P	115_I	3.303	0.99
56_A	105_L	2.628	0.95
103_N	114_N	2.592	0.94
80_I	89_D	2.465	0.93
24_V	45_V	2.335	0.91
86_S	89_D	2.265	0.89
82_D	105_L	2.187	0.87
107_L	114_N	1.982	0.82
82_D	93_P	1.920	0.79
99_I	109_D	1.892	0.78
93_P	111_K	1.863	0.77
93_P	97_M	1.859	0.77
90_L	95_R	1.847	0.77
13_R	18_P	1.834	0.76
56_A	59_A	1.780	0.74
35_K	101_K	1.741	0.72
60_Y	107_L	1.651	0.68
10_K	94_Q	1.624	0.67
22_V	25_K	1.570	0.64
30_I	38_L	1.558	0.63
108_K	111_K	1.547	0.63
19_E	23_I	1.521	0.61
36_V	74_S	1.504	0.60
60_Y	76_E	1.467	0.58
41_F	105_L	1.429	0.56
33_G	79_Q	1.365	0.53
31_T	35_K	1.347	0.52
39_V	66_V	1.340	0.51
67_Q	89_D	1.320	0.50
56_A	93_P	1.313	0.50
53_V	79_Q	1.312	0.50
46_L	53_V	1.310	0.50
81_G	99_I	1.299	0.49
33_G	73_I	1.284	0.48
55_K	110_K	1.282	0.48
99_I	115_I	1.262	0.47
29_S	65_E	1.255	0.47
59_A	69_L	1.247	0.46
95_R	112_V	1.215	0.45
13_R	73_I	1.206	0.44
39_V	81_G	1.197	0.44
93_P	99_I	1.195	0.43
8_P	69_L	1.175	0.42
27_R	38_L	1.153	0.41
82_D	85_K	1.152	0.41
39_V	97_M	1.128	0.40
59_A	66_V	1.128	0.40
33_G	86_S	1.123	0.40
84_E	106_N	1.120	0.39
46_L	50_L	1.107	0.39
78_K	82_D	1.082	0.37
45_V	92_K	1.032	0.35
50_L	105_L	1.030	0.35
60_Y	114_N	1.017	0.34
30_I	33_G	1.014	0.34
53_V	101_K	1.013	0.34
6_Y	32_L	1.011	0.34
90_L	94_Q	1.005	0.33
63_N	67_Q	1.002	0.33
15_A	37_L	0.986	0.33
55_K	60_Y	0.974	0.32
61_Q	81_G	0.968	0.32
43_A	79_Q	0.959	0.31
88_A	105_L	0.941	0.30
6_Y	64_I	0.935	0.30
97_M	107_L	0.926	0.30
55_K	76_E	0.922	0.30
65_E	112_V	0.916	0.29
56_A	67_Q	0.914	0.29
26_K	77_N	0.913	0.29
17_S	65_E	0.912	0.29
47_S	72_Q	0.909	0.29
30_I	58_A	0.905	0.29
7_Q	77_N	0.902	0.29
27_R	46_L	0.900	0.28
26_K	105_L	0.899	0.28
20_K	23_I	0.898	0.28
90_L	112_V	0.873	0.27
30_I	97_M	0.873	0.27
99_I	111_K	0.861	0.27
20_K	42_A	0.859	0.27
56_A	78_K	0.857	0.27
93_P	96_I	0.848	0.26
87_V	103_N	0.845	0.26
56_A	111_K	0.836	0.26
32_L	48_V	0.822	0.25
82_D	113_K	0.819	0.25
13_R	102_K	0.813	0.25
25_K	50_L	0.806	0.24
74_S	101_K	0.803	0.24
36_V	71_E	0.776	0.23
25_K	42_A	0.775	0.23
25_K	69_L	0.775	0.23
33_G	89_D	0.769	0.23
92_K	96_I	0.765	0.23
98_D	102_K	0.751	0.22
68_K	84_E	0.749	0.22
24_V	106_N	0.739	0.22
37_L	73_I	0.739	0.22
53_V	60_Y	0.730	0.21
50_L	79_Q	0.712	0.21
92_K	105_L	0.708	0.21
23_I	47_S	0.706	0.21
78_K	105_L	0.696	0.20
87_V	97_M	0.689	0.20
87_V	94_Q	0.687	0.20
31_T	37_L	0.687	0.20
21_K	63_N	0.684	0.20
51_L	93_P	0.683	0.20
39_V	71_E	0.675	0.19
11_Q	15_A	0.673	0.19
5_A	53_V	0.662	0.19
33_G	63_N	0.659	0.19
13_R	96_I	0.657	0.19
67_Q	70_E	0.653	0.19
17_S	72_Q	0.651	0.19
52_I	86_S	0.649	0.19
19_E	112_V	0.648	0.19
66_V	106_N	0.648	0.19
68_K	71_E	0.645	0.18
109_D	115_I	0.638	0.18
58_A	90_L	0.630	0.18
21_K	50_L	0.629	0.18
26_K	70_E	0.621	0.18
11_Q	94_Q	0.614	0.17
13_R	16_I	0.611	0.17
38_L	48_V	0.605	0.17
32_L	46_L	0.603	0.17
69_L	96_I	0.600	0.17
31_T	34_E	0.594	0.17
14_H	71_E	0.594	0.17
15_A	52_I	0.586	0.17
17_S	77_N	0.586	0.17
85_K	105_L	0.585	0.17
41_F	93_P	0.583	0.16
14_H	66_V	0.581	0.16
60_Y	85_K	0.578	0.16
11_Q	84_E	0.578	0.16
13_R	23_I	0.577	0.16
56_A	85_K	0.576	0.16
37_L	65_E	0.575	0.16
41_F	82_D	0.571	0.16
36_V	86_S	0.571	0.16
88_A	92_K	0.566	0.16
77_N	106_N	0.566	0.16
66_V	72_Q	0.563	0.16
18_P	24_V	0.563	0.16
30_I	61_Q	0.562	0.16
13_R	17_S	0.556	0.16
76_E	79_Q	0.556	0.16
44_A	84_E	0.555	0.16
63_N	79_Q	0.551	0.15
20_K	98_D	0.548	0.15
28_A	109_D	0.540	0.15
27_R	103_N	0.537	0.15
38_L	51_L	0.525	0.15
44_A	110_K	0.520	0.15
7_Q	65_E	0.519	0.15
99_I	107_L	0.515	0.14
12_Q	109_D	0.514	0.14
40_L	69_L	0.512	0.14
80_I	91_S	0.511	0.14
56_A	114_N	0.506	0.14
60_Y	113_K	0.503	0.14
21_K	37_L	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cgkA	3	0.359	33	0.923	Contact Map
4q4gX	1	0	27.3	0.926	Contact Map
3ghgA	2	0.8718	26.8	0.926	Contact Map
1a93B	1	0.2735	25	0.927	Contact Map
3viqB	1	0.453	16.7	0.933	Contact Map
1rz2A	1	0.4872	11.7	0.937	Contact Map
4etpA	1	0.5299	11.5	0.937	Contact Map
3vn0A	2	0.3504	9.9	0.939	Contact Map
1deqA	1	0.8718	9.1	0.94	Contact Map
4dznA	3	0.265	8.8	0.941	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.